Q9LUE6 · RGP4_ARATH
- ProteinProbable UDP-arabinopyranose mutase 4
- GeneRGP4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids364 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Probable UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides.
Catalytic activity
- UDP-beta-L-arabinofuranose = UDP-beta-L-arabinopyranose
Cofactor
Mg2+ (UniProtKB | Rhea| CHEBI:18420 )
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 154 | Required for activity | ||||
Sequence: R | ||||||
Site | 161 | Required for activity | ||||
Sequence: R |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | Golgi apparatus | |
Cellular Component | plastid | |
Molecular Function | intramolecular transferase activity | |
Biological Process | cell wall organization | |
Biological Process | plant-type cell wall organization or biogenesis |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameProbable UDP-arabinopyranose mutase 4
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9LUE6
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Soluble and membrane-associated.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000410987 | 1-364 | Probable UDP-arabinopyranose mutase 4 | |||
Sequence: MAGYNLEAIEAAPLKDDLDIVIPTIRSLDFLEQWRPFLHHYHLIIVQDGDPSIKIRVPEGYDYELYNRNDINRILGPRANCISYKDGGCRCFGFMVSKKKYIYTIDDDCFVAKDPSGKDINVIAQHIKNLETPSTPHYFNTLYDPFRDGTDFVRGYPFSLREGVQTAISHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKRVLYPMCGMNLAFNRELVGPAMYFGLMGEGQPISRYDDMWAGWAAKVVCDHLGFGVKTGLPYLWHSKASNPFVNLKKEHKGLHWQEDMVPFFQNLRLSKESDTAAKCYMEISNMTKEKLTKVDPYFEKLADAMVVWIEAWEELNPPVKKKQSDGKDVKAK | ||||||
Glycosylation | 154 | N-linked (Glc...) arginine | ||||
Sequence: R |
Post-translational modification
Reversibly glycosylated in vitro by UDP-glucose, UDP-xylose and UDP-galactose, but not UDP-mannose.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Specifically expressed in developing seeds.
Gene expression databases
Interaction
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 106-108 | DXD motif | ||||
Sequence: DDD |
Domain
The conserved DXD motif is involved in enzyme activity.
Sequence similarities
Belongs to the RGP family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length364
- Mass (Da)41,866
- Last updated2000-10-01 v1
- Checksum65301D7E0AA3F01D
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF329280 EMBL· GenBank· DDBJ | AAK60126.1 EMBL· GenBank· DDBJ | mRNA | ||
AB023037 EMBL· GenBank· DDBJ | BAA96988.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED95988.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT004025 EMBL· GenBank· DDBJ | AAO42061.1 EMBL· GenBank· DDBJ | mRNA | ||
BT005194 EMBL· GenBank· DDBJ | AAO50727.1 EMBL· GenBank· DDBJ | mRNA |