Q9LT56 · Q9LT56_ARATH
- ProteinAT3g27560/MMJ24_11
- GeneATN1
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids356 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion | |
Molecular Function | ATP binding | |
Molecular Function | protein serine/threonine kinase activity | |
Molecular Function | protein serine/threonine/tyrosine kinase activity | |
Biological Process | cell communication | |
Biological Process | root epidermal cell differentiation | |
Biological Process | signaling |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9LT56
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9LT56 | TGA3 Q39234 | 3 | EBI-4469161, EBI-541366 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 26-290 | Protein kinase | ||||
Sequence: LFVGPKIGEGAHAKVYEGKYRNQTVAIKIIKRGESPEEIAKRDNRFAREIAMLSKVQHKNLVKFIGACKEPMMVIVTELLLGGTLRKYLVSLRPKRLDIRLAVGFALDIARAMECLHSHGIIHRDLKPENLILSADHKTVKLADFGLAREESLTEMMTAETGTYRWMAPELYSTVTLRQGEKKHYNHKVDAYSFAIVLWELILNKLPFEGMSNLQAAYAAAFKNLRPSAEDLPGDLEMIVTSCWKEDPNERPNFTEIIQMLLRYL |
Sequence similarities
Belongs to the protein kinase superfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length356
- Mass (Da)40,096
- Last updated2000-10-01 v1
- ChecksumFA2E1C67B90AB799
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY058062 EMBL· GenBank· DDBJ | AAL24170.1 EMBL· GenBank· DDBJ | mRNA | ||
AY090300 EMBL· GenBank· DDBJ | AAL90961.1 EMBL· GenBank· DDBJ | mRNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE77337.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB025626 EMBL· GenBank· DDBJ | BAB01286.1 EMBL· GenBank· DDBJ | Genomic DNA |