Q9LQ89 · ROGF2_ARATH
- ProteinRop guanine nucleotide exchange factor 2
- GeneROPGEF2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids485 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Guanine-nucleotide exchange factor (GEF) that acts as an activator of Rop (Rho of plants) GTPases by promoting the exchange of GDP for GTP.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | guanyl-nucleotide exchange factor activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameRop guanine nucleotide exchange factor 2
- Short namesAtRopGEF2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9LQ89
Proteomes
Organism-specific databases
Genome annotation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000234059 | 1-485 | Rop guanine nucleotide exchange factor 2 | |||
Sequence: MENLPNHEENDDVGYHQSPGPIDPNDHSASETPVYSTMSTDSFAYHRTCSETSGGGFSDQIDETSSFCTEASPSDWPVLTESNNSASSNFPTVFDLKHNQIETDEHLAVQEISEPELETMKERFSKLLLGEDMSGSGKGVCTAVTISNAITNLYATVFGQNLRLEPLEIEQKTTWKREMNCLLSVCDYIFEFIPKSQNLSNGATVEVMESRPRADIYINLPALRKLDSMLMEALDSFQKTEFWYAEEGSLSMKSTRSATGSFRKVIVQRKEEKWWLPIPLVPLQGLSEKARKQLKSKRESTNQIHKAAMAINSSILGEMDIPDSYMATLPKSGKASTGDAIYRHMTSSGRFSPEKLLDRLKIVSEHEALQLADRVEASMYTWRRKACLNNSKSSWNMVKDLMSITERSDKNYVLAERAESLLFCLKQRYPELSQTSLDICKIHCNKDVGKAVLESYSRVLEGLAFNIVAWIDDVLYVDKTMRGEE |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the vascular tissues of roots, leaves, sepals, petals and siliques.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-36 | Disordered | ||||
Sequence: MENLPNHEENDDVGYHQSPGPIDPNDHSASETPVYS | ||||||
Domain | 107-485 | PRONE | ||||
Sequence: LAVQEISEPELETMKERFSKLLLGEDMSGSGKGVCTAVTISNAITNLYATVFGQNLRLEPLEIEQKTTWKREMNCLLSVCDYIFEFIPKSQNLSNGATVEVMESRPRADIYINLPALRKLDSMLMEALDSFQKTEFWYAEEGSLSMKSTRSATGSFRKVIVQRKEEKWWLPIPLVPLQGLSEKARKQLKSKRESTNQIHKAAMAINSSILGEMDIPDSYMATLPKSGKASTGDAIYRHMTSSGRFSPEKLLDRLKIVSEHEALQLADRVEASMYTWRRKACLNNSKSSWNMVKDLMSITERSDKNYVLAERAESLLFCLKQRYPELSQTSLDICKIHCNKDVGKAVLESYSRVLEGLAFNIVAWIDDVLYVDKTMRGEE |
Domain
The PRONE (plant-specific Rop nucleotide exchanger) domain is responsible for the GEF activity.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length485
- Mass (Da)54,699
- Last updated2009-03-24 v2
- ChecksumE7C2574C8810E4EA
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8ASC5 | A0A1P8ASC5_ARATH | ROPGEF2 | 372 | ||
A0A1P8ASE8 | A0A1P8ASE8_ARATH | ROPGEF2 | 461 | ||
A0A1P8ASA3 | A0A1P8ASA3_ARATH | ROPGEF2 | 515 |
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC009273 EMBL· GenBank· DDBJ | AAF78400.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002684 EMBL· GenBank· DDBJ | AEE27324.1 EMBL· GenBank· DDBJ | Genomic DNA |