Q9LNN7 · GRI_ARATH
- ProteinProtein GRIM REAPER
- GeneGRI
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids168 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in the regulation of cell death induced by extracellular reactive oxygen species (PubMed:19279211, PubMed:25398910).
Only the processed peptide, and not the full length GRI can bind in vivo to the extracellular domain of the receptor PRK5 (PubMed:25398910).
The GRIp-induced cell death is superoxide and salicylic acid dependent (PubMed:19279211).
Only the processed peptide, and not the full length GRI can bind in vivo to the extracellular domain of the receptor PRK5 (PubMed:25398910).
The GRIp-induced cell death is superoxide and salicylic acid dependent (PubMed:19279211).
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 67-68 | Cleavage; by AMC9 | ||||
Sequence: RL | ||||||
Site | 78-79 | Cleavage; by AMC9 | ||||
Sequence: KG |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apoplast | |
Cellular Component | extracellular space | |
Biological Process | defense response to bacterium | |
Biological Process | jasmonic acid mediated signaling pathway | |
Biological Process | regulation of jasmonic acid biosynthetic process | |
Biological Process | regulation of salicylic acid biosynthetic process | |
Biological Process | response to ozone | |
Biological Process | salicylic acid mediated signaling pathway | |
Biological Process | seed development |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProtein GRIM REAPER
- Alternative names
- Cleaved into 1 chains
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9LNN7
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation, peptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-30 | |||||
Sequence: MVIKIPNTFIKATSLLSLILYFLIIATSKS | ||||||
Chain | PRO_0000431926 | 31-168 | Protein GRIM REAPER | |||
Sequence: NSVLADEVVDQEDDPEYYILDETPSILSNVTISSKTRLLVSHYKKIKKGMRCHVESYNICNGVKANKGTSLLHCCKKHCRNVLGDRNNCGRCGHKCGFGQRCCGGVCTYVNFNPNHCGKCTRKCASGVKCEYGYCGYA | ||||||
Glycosylation | 59 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Peptide | PRO_0000431927 | 68-78 | GRIp | |||
Sequence: LLVSHYKKIKK |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Highly expressed in flowers, and at very low levels in leaves.
Gene expression databases
Interaction
Subunit
Interacts with PRK5 and to a lower extent with PRK4.
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length168
- Mass (Da)18,607
- Last updated2000-10-01 v1
- ChecksumB5079E3CEC668A09
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC022520 EMBL· GenBank· DDBJ | AAF87867.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE32894.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK176040 EMBL· GenBank· DDBJ | BAD43803.1 EMBL· GenBank· DDBJ | mRNA | ||
BT010530 EMBL· GenBank· DDBJ | AAQ65153.1 EMBL· GenBank· DDBJ | mRNA |