Q9LML6 · U71C4_ARATH
- ProteinFlavonol 3-O-glucosyltransferase UGT71C4
- GeneUGT71C4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids479 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Possesses quercetin 3-O-glucosyltransferase and 7-O-glucosyltransferase activities in vitro. Also active in vitro on benzoates and benzoate derivatives.
Catalytic activity
- a flavonol + UDP-alpha-D-glucose = a flavonol 3-O-beta-D-glucoside + H+ + UDP
Features
Showing features for active site, binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 17 | Proton acceptor | ||||
Sequence: H | ||||||
Binding site | 17 | an anthocyanidin (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Active site | 127 | Charge relay | ||||
Sequence: D | ||||||
Binding site | 150 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 350 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: A | ||||||
Binding site | 352 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 367 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 370 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: W | ||||||
Binding site | 371 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 372 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 375 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 390 | an anthocyanidin (UniProtKB | ChEBI) | ||||
Sequence: A | ||||||
Binding site | 391 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 392 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: Q |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | daphnetin 3-O-glucosyltransferase activity | |
Molecular Function | flavonol 3-O-glucosyltransferase activity | |
Molecular Function | flavonol 7-O-beta-glucosyltransferase activity | |
Molecular Function | myricetin 3-O-glucosyltransferase activity | |
Molecular Function | quercetin 3-O-glucosyltransferase activity | |
Molecular Function | quercetin 7-O-glucosyltransferase activity | |
Molecular Function | UDP-glucosyltransferase activity |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameFlavonol 3-O-glucosyltransferase UGT71C4
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9LML6
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000409056 | 1-479 | Flavonol 3-O-glucosyltransferase UGT71C4 | |||
Sequence: MVKETELIFIPVPSTGHILVHIEFAKRLINLDHRIHTITILNLSSPSSPHASVFARSLIASQPKIRLHDLPPIQDPPPFDLYQRAPEAYIVKLIKKNTPLIKDAVSSIVASRRGGSDSVQVAGLVLDLFCNSLVKDVGNELNLPSYIYLTCNARYLGMMKYIPDRHRKIASEFDLSSGDEELPVPGFINAIPTKFMPPGLFNKEAYEAYVELAPRFADAKGILVNSFTELEPHPFDYFSHLEKFPPVYPVGPILSLKDRASPNEEAVDRDQIVGWLDDQPESSVVFLCFGSRGSVDEPQVKEIARALELVGCRFLWSIRTSGDVETNPNDVLPEGFMGRVAGRGLVCGWAPQVEVLAHKAIGGFVSHCGWNSTLESLWFGVPVATWPMYAEQQLNAFTLVKELGLAVDLRMDYVSSRGGLVTCDEIARAVRSLMDGGDEKRKKVKEMADAARKALMDGGSSSLATARFIAELFEDGSSC |
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length479
- Mass (Da)52,844
- Last updated2001-03-01 v2
- ChecksumBEAFE2D5C86F8920
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC067971 EMBL· GenBank· DDBJ | AAG18592.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE28097.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY040019 EMBL· GenBank· DDBJ | AAK64176.2 EMBL· GenBank· DDBJ | mRNA | ||
BT001938 EMBL· GenBank· DDBJ | AAN71937.1 EMBL· GenBank· DDBJ | mRNA |