Q9LFP3 · GLYT4_ARATH
- ProteinProbable glycosyltransferase At5g11130
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids480 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
May be involved in cell wall biosynthesis.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Golgi membrane | |
Molecular Function | glycosyltransferase activity | |
Biological Process | cell wall organization | |
Biological Process | protein glycosylation |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameProbable glycosyltransferase At5g11130
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9LFP3
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Golgi apparatus membrane ; Single-pass type II membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-4 | Cytoplasmic | ||||
Sequence: MADL | ||||||
Transmembrane | 5-25 | Helical; Signal-anchor for type II membrane protein | ||||
Sequence: TCTTPFLLYPSLVIILFFYSI | ||||||
Topological domain | 26-480 | Lumenal | ||||
Sequence: NHHNQIFSSVVDDDPSCRLSSSPQAVFSSFRIFPFRSSSSCLNITSNNNSTSEVVVVEEVDEAVERIEEGLAMARAAIRKAGEKNLRRDRDRTNNSDVGVVSNGSVYLNAFTFHQSHKEMEKRFKIWTYREGEAPLFHKGPLNNIYAIEGQFMDEIENGNSRFKAASPEEATVFYIPVGIVNIIRFVYRPYTSYARDRLQNIVKDYISLISNRYPYWNRSRGADHFFLSCHDWAPDVSAVDPELYKHFIRALCNANSSEGFTPMRDVSLPEINIPHSQLGFVHTGEPPQNRKLLAFFAGGSHGDVRKILFQHWKEKDKDVLVYENLPKTMNYTKMMDKAKFCLCPSGWEVASPRIVESLYSGCVPVIIADYYVLPFSDVLNWKTFSVHIPISKMPDIKKILEAITEEEYLNMQRRVLEVRKHFVINRPSKPYDMLHMIMHSIWLRRLNVRIPLSQ |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000392295 | 1-480 | Probable glycosyltransferase At5g11130 | |||
Sequence: MADLTCTTPFLLYPSLVIILFFYSINHHNQIFSSVVDDDPSCRLSSSPQAVFSSFRIFPFRSSSSCLNITSNNNSTSEVVVVEEVDEAVERIEEGLAMARAAIRKAGEKNLRRDRDRTNNSDVGVVSNGSVYLNAFTFHQSHKEMEKRFKIWTYREGEAPLFHKGPLNNIYAIEGQFMDEIENGNSRFKAASPEEATVFYIPVGIVNIIRFVYRPYTSYARDRLQNIVKDYISLISNRYPYWNRSRGADHFFLSCHDWAPDVSAVDPELYKHFIRALCNANSSEGFTPMRDVSLPEINIPHSQLGFVHTGEPPQNRKLLAFFAGGSHGDVRKILFQHWKEKDKDVLVYENLPKTMNYTKMMDKAKFCLCPSGWEVASPRIVESLYSGCVPVIIADYYVLPFSDVLNWKTFSVHIPISKMPDIKKILEAITEEEYLNMQRRVLEVRKHFVINRPSKPYDMLHMIMHSIWLRRLNVRIPLSQ | ||||||
Glycosylation | 68 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 74 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 119 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 128 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 243 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 281 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 356 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Sequence similarities
Belongs to the glycosyltransferase 47 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length480
- Mass (Da)55,363
- Last updated2010-03-23 v2
- ChecksumF36A2AEF32C55766
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
W8PUF9 | W8PUF9_ARATH | At5g11130 | 336 |
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL360314 EMBL· GenBank· DDBJ | CAB96647.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AL360314 EMBL· GenBank· DDBJ | CAB96648.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002688 EMBL· GenBank· DDBJ | AED91637.1 EMBL· GenBank· DDBJ | Genomic DNA |