Q9LFL6 · BKN2_ARATH
- ProteinInactive serine/threonine-protein kinase BKN2
- GeneBKN2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids336 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Together with SZE1 and ZED1, required for effector-triggered immunity (e.g. Pseudomonas syringae type III effector HopZ1a) via the activation of ZAR1, thus being essential for resistance against P. syringae pv. tomato DC3000 expressing HopZ1a (PubMed:30947022).
Collaboratively with BKN1, involved in compatible pollen-stigma interactions (PubMed:31829135).
Collaboratively with BKN1, involved in compatible pollen-stigma interactions (PubMed:31829135).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Cellular Component | plasma membrane | |
Molecular Function | ATP binding | |
Molecular Function | protein serine/threonine kinase activity | |
Biological Process | defense response | |
Biological Process | pollen-stigma interaction |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameInactive serine/threonine-protein kinase BKN2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9LFL6
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
No visible phenotype (PubMed:31829135).
Slight hydration defects of wild-type pollen placed on the stigma (PubMed:31829135).
Slight hydration defects of wild-type pollen placed on the stigma of plants lacking both BKN1 and BKN2, but normal pollen grain adhesion and pollen tube growth (PubMed:31829135).
Partial suppression of the pleiotropic phenotypes conferred by the dominant mutation zed1-D (e.g. high-temperature-dependent growth retardation and autoimmunity) (PubMed:30947022).
Slight hydration defects of wild-type pollen placed on the stigma (PubMed:31829135).
Slight hydration defects of wild-type pollen placed on the stigma of plants lacking both BKN1 and BKN2, but normal pollen grain adhesion and pollen tube growth (PubMed:31829135).
Partial suppression of the pleiotropic phenotypes conferred by the dominant mutation zed1-D (e.g. high-temperature-dependent growth retardation and autoimmunity) (PubMed:30947022).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 2 | Abolished N-terminal myristoylation leading to disrupted plasma membrane localization and inhability to suppress zed1-D-activated immunity. | ||||
Sequence: G → A | ||||||
Mutagenesis | 4 | Disrupted plasma membrane localization. | ||||
Sequence: C → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 42 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for initiator methionine, lipidation, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Lipidation | 2 | N-myristoyl glycine | ||||
Sequence: G | ||||||
Chain | PRO_0000457802 | 2-336 | Inactive serine/threonine-protein kinase BKN2 | |||
Sequence: GNCLKPLKEQPPSASPKPLTIPSSSVEPVKENLKEFRFAELNKATKRFRKYMVIKGNDNGFTRTFYEGCINETTFAPSRTGITVSVMECYQDNSQTLQDWKEEVKSLGRISHPNLVKLLGYCCEENKSFLVFEYLHKGSLNRYIFGKEEEALPWETRVKIAIGAAQSIAFLHWVKNSALYRELRMYNILLDEHYNTKLFYLGSKKLCLLEESVTTAFIGRTVYIPPEYVISGHLGTKSDVYTFGVILLEILTGLKASDGKKNENMQSLHVWTKPFLSDQSKIREIIDPRLGNDYPVNAATQMGKLIKRCIKLDTRKRPSMQQVFDGLNDIAEIKD | ||||||
Lipidation | 4 | S-palmitoyl cysteine | ||||
Sequence: C |
Post-translational modification
N-terminal myristoylation is critical for plasma membrane localization and implication in defense responses.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-25 | Disordered | ||||
Sequence: MGNCLKPLKEQPPSASPKPLTIPSS | ||||||
Domain | 52-332 | Protein kinase | ||||
Sequence: YMVIKGNDNGFTRTFYEGCINETTFAPSRTGITVSVMECYQDNSQTLQDWKEEVKSLGRISHPNLVKLLGYCCEENKSFLVFEYLHKGSLNRYIFGKEEEALPWETRVKIAIGAAQSIAFLHWVKNSALYRELRMYNILLDEHYNTKLFYLGSKKLCLLEESVTTAFIGRTVYIPPEYVISGHLGTKSDVYTFGVILLEILTGLKASDGKKNENMQSLHVWTKPFLSDQSKIREIIDPRLGNDYPVNAATQMGKLIKRCIKLDTRKRPSMQQVFDGLNDIA |
Domain
The protein kinase domain is predicted to be catalytically inactive.
Sequence similarities
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length336
- Mass (Da)38,399
- Last updated2000-10-01 v1
- Checksum404D8C0B922EFE7B
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8BCD9 | A0A1P8BCD9_ARATH | SZE2 | 246 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL360314 EMBL· GenBank· DDBJ | CAB96676.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED91674.1 EMBL· GenBank· DDBJ | Genomic DNA |