Q9JLT2 · TREA_MOUSE
- ProteinTrehalase
- GeneTreh
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids576 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Intestinal trehalase is probably involved in the hydrolysis of ingested trehalose.
Catalytic activity
- alpha,alpha-trehalose + H2O = alpha-D-glucose + beta-D-glucose
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 165 | substrate | ||||
Sequence: R | ||||||
Binding site | 172-173 | substrate | ||||
Sequence: WD | ||||||
Binding site | 209 | substrate | ||||
Sequence: N | ||||||
Binding site | 218-220 | substrate | ||||
Sequence: RSQ | ||||||
Binding site | 283-285 | substrate | ||||
Sequence: RPE | ||||||
Binding site | 316 | substrate | ||||
Sequence: G | ||||||
Active site | 318 | Proton donor/acceptor | ||||
Sequence: D | ||||||
Active site | 511 | Proton donor/acceptor | ||||
Sequence: E | ||||||
Binding site | 526 | substrate | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | brush border | |
Cellular Component | membrane | |
Cellular Component | plasma membrane | |
Cellular Component | side of membrane | |
Molecular Function | alpha,alpha-trehalase activity | |
Biological Process | animal organ morphogenesis | |
Biological Process | trehalose catabolic process |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameTrehalase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9JLT2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation, lipidation, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MTWELHLLLLLGLGLRSQEA | ||||||
Chain | PRO_0000012053 | 21-553 | Trehalase | |||
Sequence: LPPPCESQIYCHGELLHQVQMAQLYQDDKQFVDMSLATSPDEVLQKFSELATVHNHSIPKEQLQEFVQSHFQPVGQELQSWTPEDWKDSPQFLQKISDANLRVWAEELHKIWKKLGKKMKAEVLSYPERSSLIYSKHPFIVPGGRFVEFYYWDSYWVMEGLLLSEMASTVKGMLQNFLDLVKTYGHIPNGGRIYYLQRSQPPLLTLMMDRYVAHTKDVAFLQENIGTLASELDFWTVNRTVSVVSGGQSYVLNRYYVPYGGPRPESYRKDAELANSVPEGDRETLWAELKAGAESGWDFSSRWLVGGPDPDLLSSIRTSKMVPADLNAFLCQAEELMSNFYSRLGNDTEATKYRNLRAQRLAAMEAVLWDEQKGAWFDYDLEKGKKNLEFYPSNLSPLWAGCFSDPSVADKALKYLEDSKILTYQYGIPTSLRNTGQQWDFPNAWAPLQDLVIRGLAKSASPRTQEVAFQLAQNWIKTNFKVYSQKSAMFEKYDISNGGHPGGGGEYEVQEGFGWTNGLALMLLDRYGDQLTS | ||||||
Glycosylation | 75 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 258 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 366 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Lipidation | 553 | GPI-anchor amidated serine | ||||
Sequence: S | ||||||
Propeptide | PRO_0000012054 | 554-576 | Removed in mature form | |||
Sequence: GTQLASLGPHCLVAALLLSLLLQ |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length576
- Mass (Da)65,401
- Last updated2000-10-01 v1
- Checksum53CDA6A10511520E
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 82 | in Ref. 3; AAK97631 | ||||
Sequence: Q → R | ||||||
Sequence conflict | 416 | in Ref. 3; AAK97631 | ||||
Sequence: S → T |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF136944 EMBL· GenBank· DDBJ | AAF61430.1 EMBL· GenBank· DDBJ | mRNA | ||
AK008912 EMBL· GenBank· DDBJ | BAB25963.1 EMBL· GenBank· DDBJ | mRNA | ||
AF404760 EMBL· GenBank· DDBJ | AAK97631.1 EMBL· GenBank· DDBJ | Genomic DNA |