Q9JLH5 · CK5P2_RAT
- ProteinCDK5 regulatory subunit-associated protein 2
- GeneCdk5rap2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1903 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Potential regulator of CDK5 activity via its interaction with CDK5R1. Negative regulator of centriole disengagement (licensing) which maintains centriole engagement and cohesion. Involved in regulation of mitotic spindle orientation (By similarity).
Plays a role in the spindle checkpoint activation by acting as a transcriptional regulator of both BUBR1 and MAD2 promoter. Required for the recruitment of AKAP9 to centrosomes (By similarity).
Plays a role in neurogenesis. Contrary to higher mammalian orthologs, including human, chimpanzee, bovine and dog, does not interact with EB1/MAPRE1, therefore its function in the regulation of microtubule dynamics is unclear (By similarity).
Plays a role in the spindle checkpoint activation by acting as a transcriptional regulator of both BUBR1 and MAD2 promoter. Required for the recruitment of AKAP9 to centrosomes (By similarity).
Plays a role in neurogenesis. Contrary to higher mammalian orthologs, including human, chimpanzee, bovine and dog, does not interact with EB1/MAPRE1, therefore its function in the regulation of microtubule dynamics is unclear (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCDK5 regulatory subunit-associated protein 2
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ9JLH5
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Found in the pericentriolar region adhering to the surface of the centrosome and in the region of the centrosomal appendages. Localization to centrosomes versus Golgi apparatus may be cell type-dependent. Due to the probable lack of interaction with EB1/MAPRE1, its localization to microtubule plus ends may not be conserved in rats.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000089838 | 1-1903 | CDK5 regulatory subunit-associated protein 2 | |||
Sequence: MMDSGMEEDVTLPGTLSGCSGLHPVLPSDLDVISDTTGLGNGVLPIMSEEKVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERIQQEFAGPTEHIYKKNIELKVEVESLKRELQERDQLLVKASKAVESLAEGGGSEIQRVKEDARKKVQQVEELLTKRIHLLEEDVKAAQAELEKAFAGTETEKALRLSLESKLSAMKKMQEGDLEMTLALEEKDRLIEELKLSLKSKEALIQCLKEEKSQMASPDENVSSGELRGLSATLREEKERDAEERQKERNHFEERIQALQEDLREKEREIATEKKNSLKRDKAIQGLTMALKSKEKEVEELNSIIKELTADSTQSREAPLKTQVSEFEVRESENCEAALAEKEALLAKLHSENVTKNTENHRLLRNVKKVTQELNDLKKEKLRLERDLEEAHREGNRGARTIHDLRNEVEKLRKEVCEREKAVEKHYKSLPGESSSKFHSQEQVVKGLTESASQEDLLLQKSNEKDLEAIQQNCYLMTAEELKFGSDGLITEKCSQQSPDSKLIFSKEKQQSEYEGLTGDLKTEQNVYAHLAKNLQDTDSKLQAELKRVLALRKQLEQDVLAYRNLQTALQEQLSEIRKREEEPFSFYSDQTSYLSICLEEHSQFQLEHFSQEEIKKKVIDLIQLVKDLHADNQHLKKTIFDISCMGVQGNDRLESTKQAELMASKADEDTLKFKADDENHFQSDQHLEQSREIMEDYAEGGGKDGYVRHMDSNILDHDGAHTPDTSEDHSLEDELLSLLATFFSKKATPSLESRPDLLKALGALLLERICLAEQGSPGDHSDSKAEKALEQVAVRLRDELGHSCLANSFSKSHSELKSPRGTWLVKTGDEAKVELKSVSVQTMTIEDSTRGFKPERKREAWAGKPEEAVFSTELESEALGEMPGLQATHLSFPSAIDKDDQKTGLLIQLKTPELLENLYNLPASQEVVAQLQGQVLELQKELKEYKIRNKQLLDKLILAEAMMEGMAVPNSTPVNVPAAQAVVRTAFQGKPGEQEGHETTHSAGRDKEVDSDQYTSFEIDSEICPPDDLALLPACKENLEDFLGPPSIATYLDSKSQLSVKVSVVGTDQSENINLPDDTEALKQKIHDLQTELEGYRNIIVQLQKHSQCSEAIITVLCGTEGAQDGLNKPKGHIDEEEMTFSSLHQVRYVKHMKILRPLTPEIIDGKMLESLKQQLVEQEQELQKEQDLNLELFGEIHNLQNKFRDLSPSRYDSLVQSQARELSLQRQQIKDSHDICVVCHQHMSTMIKAFEELLQASDVDSCVAEGFREQLTQCAGLLEQLEKLFLHGKSARVEPHTQTELLRRLRTEEDNLPYQHLLPESPEPSASHALSDDEMSEKSFLSREPKPDSETEKYPTIASRFPQDLLMEHIQEIRTLRKHLEESIKTNEKLRKQLERQGCETDQGSTNVSAYSSELHNSLTSEIQFLRKQNEALSTMLEKGSKEKQKENEKLRESLARKTESLEHLQLEYASVREENERLRRDISEKERQNQQLTQEVCSSLQELSRVQEEAKSRQQLLLQKDELLQSLQMELKVYEKLAEEHQKLQQESRGEACGGGQKGQDPFSNLHGLLKEIQVLRDQAERSIQTNNTLKSKLEKQLSQGSKQAQEGALTLAVQALSVTEWSLQLDKHDVNKCPEASDNSFDLFESTQAMAPKSASETPVLSGTDVDSLSCDSTSSATSPSCMPCLVAGRHLWASKSGHHMLCLIEDYDALYKQISWGQTLLAKMDIQTQEALSPTSQKLGPKASFSVPLSKFLSSMNTAKLILEKASRLLKLFWRVSVPTNGQCSLHCDQIGEMKAEITKLHKKLFEQEKKLQNTAKLLQQSKHQEKIIFDQLVITHQVLRKARGNLELRPRAAHPGTSSPSRPGS | ||||||
Modified residue | 485 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 544 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1193 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 1241 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1243 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1495 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1673 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1676 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1903 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Phosphorylated in vitro by CDK5.
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with CDK5R1 (p35 form) (PubMed:10721722).
CDK5RAP1, CDK5RAP2 and CDK5RAP3 show competitive binding to CDK5R1. May form a complex with CDK5R1 and CDK5. Interacts (via C-terminus) with PCNT; the interaction is leading to centrosomal localization of CDK5RAP2 and PCNT (By similarity).
Interacts with AKAP9; the interaction is leading to Golgi localization of CDK5RAP2 and AKAP9. Interacts with TUBG1; the interaction is leading to the centrosomal localization of CDK5RAP2 and TUBG1. Interacts with TUBGCP3. Interacts with CALM1. Interacts with CDC20. Interacts with CEP68; degradation of CEP68 in early mitosis leads to removal of CDK5RAP2 from the centrosome which promotes centriole disengagement and subsequent centriole separation. Interacts with NCKAP5L. Interacts with LGALS3BP; this interaction may connect the pericentrosomal complex to the gamma-tubulin ring complex (gamma-TuRC) to promote microtubule assembly and acetylation (By similarity).
Contrary to human, chimpanzee, bovine and dog orthologous proteins, does not interact with EB1/MAPRE1, possibly due to a divergence at the level of the critical residue 939, which is a proline in MAPRE1-binding orthologs and a leucine in mouse and rat (Probable)
CDK5RAP1, CDK5RAP2 and CDK5RAP3 show competitive binding to CDK5R1. May form a complex with CDK5R1 and CDK5. Interacts (via C-terminus) with PCNT; the interaction is leading to centrosomal localization of CDK5RAP2 and PCNT (By similarity).
Interacts with AKAP9; the interaction is leading to Golgi localization of CDK5RAP2 and AKAP9. Interacts with TUBG1; the interaction is leading to the centrosomal localization of CDK5RAP2 and TUBG1. Interacts with TUBGCP3. Interacts with CALM1. Interacts with CDC20. Interacts with CEP68; degradation of CEP68 in early mitosis leads to removal of CDK5RAP2 from the centrosome which promotes centriole disengagement and subsequent centriole separation. Interacts with NCKAP5L. Interacts with LGALS3BP; this interaction may connect the pericentrosomal complex to the gamma-tubulin ring complex (gamma-TuRC) to promote microtubule assembly and acetylation (By similarity).
Contrary to human, chimpanzee, bovine and dog orthologous proteins, does not interact with EB1/MAPRE1, possibly due to a divergence at the level of the critical residue 939, which is a proline in MAPRE1-binding orthologs and a leucine in mouse and rat (Probable)
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 244-282 | Disordered | ||||
Sequence: KSQMASPDENVSSGELRGLSATLREEKERDAEERQKERN | ||||||
Compositional bias | 263-282 | Basic and acidic residues | ||||
Sequence: SATLREEKERDAEERQKERN | ||||||
Region | 1022-1044 | Disordered | ||||
Sequence: GKPGEQEGHETTHSAGRDKEVDS | ||||||
Compositional bias | 1027-1044 | Basic and acidic residues | ||||
Sequence: QEGHETTHSAGRDKEVDS | ||||||
Region | 1349-1387 | Disordered | ||||
Sequence: QHLLPESPEPSASHALSDDEMSEKSFLSREPKPDSETEK | ||||||
Compositional bias | 1364-1387 | Basic and acidic residues | ||||
Sequence: LSDDEMSEKSFLSREPKPDSETEK | ||||||
Region | 1736-1778 | Interaction with CDK5R1 | ||||
Sequence: HMLCLIEDYDALYKQISWGQTLLAKMDIQTQEALSPTSQKLGP | ||||||
Region | 1736-1903 | Required for centrosomal attachment, Golgi localization and CALM1 interaction | ||||
Sequence: HMLCLIEDYDALYKQISWGQTLLAKMDIQTQEALSPTSQKLGPKASFSVPLSKFLSSMNTAKLILEKASRLLKLFWRVSVPTNGQCSLHCDQIGEMKAEITKLHKKLFEQEKKLQNTAKLLQQSKHQEKIIFDQLVITHQVLRKARGNLELRPRAAHPGTSSPSRPGS | ||||||
Region | 1871-1880 | Required for centrosomal attachment, Golgi localization and CALM1 interaction | ||||
Sequence: VITHQVLRKA | ||||||
Region | 1883-1903 | Disordered | ||||
Sequence: NLELRPRAAHPGTSSPSRPGS |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,903
- Mass (Da)215,482
- Last updated2018-02-28 v2
- Checksum770918B8FFD50B84
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8I6AL63 | A0A8I6AL63_RAT | Cdk5rap2 | 1776 | ||
A0A0G2K6K7 | A0A0G2K6K7_RAT | Cdk5rap2 | 1869 | ||
A0A8I6A2Q6 | A0A8I6A2Q6_RAT | Cdk5rap2 | 1794 | ||
A0A8I6A3L0 | A0A8I6A3L0_RAT | Cdk5rap2 | 1859 | ||
F1M4B7 | F1M4B7_RAT | Cdk5rap2 | 1820 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 263-282 | Basic and acidic residues | ||||
Sequence: SATLREEKERDAEERQKERN | ||||||
Compositional bias | 1027-1044 | Basic and acidic residues | ||||
Sequence: QEGHETTHSAGRDKEVDS | ||||||
Compositional bias | 1364-1387 | Basic and acidic residues | ||||
Sequence: LSDDEMSEKSFLSREPKPDSETEK |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
JX524852 EMBL· GenBank· DDBJ | AFV70628.1 EMBL· GenBank· DDBJ | mRNA | ||
AF177478 EMBL· GenBank· DDBJ | AAF60224.1 EMBL· GenBank· DDBJ | mRNA |