Q9JKX3 · TFR2_MOUSE
- ProteinTransferrin receptor protein 2
- GeneTfr2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids798 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Mediates cellular uptake of transferrin-bound iron in a non-iron dependent manner. May be involved in iron metabolism, hepatocyte function and erythrocyte differentiation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasmic vesicle | |
Cellular Component | external side of plasma membrane | |
Cellular Component | HFE-transferrin receptor complex | |
Cellular Component | membrane | |
Molecular Function | co-receptor binding | |
Molecular Function | transferrin receptor activity | |
Biological Process | acute-phase response | |
Biological Process | cellular response to iron ion | |
Biological Process | endocytic iron import into cell | |
Biological Process | intracellular iron ion homeostasis | |
Biological Process | multicellular organismal-level iron ion homeostasis | |
Biological Process | positive regulation of endocytosis | |
Biological Process | positive regulation of peptide hormone secretion | |
Biological Process | positive regulation of protein maturation | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | transferrin transport |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameTransferrin receptor protein 2
- Short namesTfR2
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9JKX3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type II membrane protein
Isoform 3
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-81 | Cytoplasmic | ||||
Sequence: MEQRWGLLRRVQQWSPRPSQTIYRRVEGPQLEHLEEEDREEGAELPAQFCPMELKGPEHLGSCPGRSIPIPWAAAGRKAAP | ||||||
Transmembrane | 82-102 | Helical; Signal-anchor for type II membrane protein | ||||
Sequence: YLVLITLLIFTGAFLLGYVAF | ||||||
Topological domain | 103-798 | Extracellular | ||||
Sequence: RGSCQACGDSVLVVDEDVNPEDSGRTTLYWSDLQAMFLRFLGEGRMEDTIRLTSLRERVAGSARMATLVQDILDKLSRQKLDHVWTDTHYVGLQFPDPAHANTLHWVDADGSVQEQLPLEDPEVYCPYSATGNATGKLVYAHYGRSEDLQDLKAKGVELAGSLLLVRVGITSFAQKVAVAQDFGAQGVLIYPDPSDFSQDPHKPGLSSHQAVYGHVHLGTGDPYTPGFPSFNQTQFPPVESSGLPSIPAQPISADIADQLLRKLTGPVAPQEWKGHLSGSPYRLGPGPDLRLVVNNHRVSTPISNIFACIEGFAEPDHYVVIGAQRDAWGPGAAKSAVGTAILLELVRTFSSMVSNGFRPRRSLLFISWDGGDFGSVGATEWLEGYLSVLHLKAVVYVSLDNSVLGDGKFHAKTSPLLVSLIENILKQVDSPNHSGQTLYEQVALTHPSWDAEVIQPLPMDSSAYSFTAFAGVPAVEFSFMEDDRVYPFLHTKEDTYENLHKMLRGRLPAVVQAVAQLAGQLLIRLSHDHLLPLDFGRYGDVVLRHIGNLNEFSGDLKERGLTLQWVYSARGDYIRAAEKLRKEIYSSERNDERLMRMYNVRIMRVEFYFLSQYVSPADSPFRHIFLGQGDHTLGALVDHLRMLRADGSGAASSRLTAGLGFQESRFRRQLALLTWTLQGAANALSGDVWNIDNNF |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000174137 | 1-798 | Transferrin receptor protein 2 | |||
Sequence: MEQRWGLLRRVQQWSPRPSQTIYRRVEGPQLEHLEEEDREEGAELPAQFCPMELKGPEHLGSCPGRSIPIPWAAAGRKAAPYLVLITLLIFTGAFLLGYVAFRGSCQACGDSVLVVDEDVNPEDSGRTTLYWSDLQAMFLRFLGEGRMEDTIRLTSLRERVAGSARMATLVQDILDKLSRQKLDHVWTDTHYVGLQFPDPAHANTLHWVDADGSVQEQLPLEDPEVYCPYSATGNATGKLVYAHYGRSEDLQDLKAKGVELAGSLLLVRVGITSFAQKVAVAQDFGAQGVLIYPDPSDFSQDPHKPGLSSHQAVYGHVHLGTGDPYTPGFPSFNQTQFPPVESSGLPSIPAQPISADIADQLLRKLTGPVAPQEWKGHLSGSPYRLGPGPDLRLVVNNHRVSTPISNIFACIEGFAEPDHYVVIGAQRDAWGPGAAKSAVGTAILLELVRTFSSMVSNGFRPRRSLLFISWDGGDFGSVGATEWLEGYLSVLHLKAVVYVSLDNSVLGDGKFHAKTSPLLVSLIENILKQVDSPNHSGQTLYEQVALTHPSWDAEVIQPLPMDSSAYSFTAFAGVPAVEFSFMEDDRVYPFLHTKEDTYENLHKMLRGRLPAVVQAVAQLAGQLLIRLSHDHLLPLDFGRYGDVVLRHIGNLNEFSGDLKERGLTLQWVYSARGDYIRAAEKLRKEIYSSERNDERLMRMYNVRIMRVEFYFLSQYVSPADSPFRHIFLGQGDHTLGALVDHLRMLRADGSGAASSRLTAGLGFQESRFRRQLALLTWTLQGAANALSGDVWNIDNNF | ||||||
Disulfide bond | 106 | Interchain | ||||
Sequence: C | ||||||
Disulfide bond | 109 | Interchain | ||||
Sequence: C | ||||||
Glycosylation | 235 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 334 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 535 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Predominantly expressed in liver. Also expressed in kidney, spleen, brain, lung, heart and muscle with very low expression in kidney, muscle and heart.
Induction
Down-regulated during erythrocyte differentiation. Expression unchanged by cellular iron status.
Developmental stage
First expressed between embryo days 8 and 11. In the liver, expression increases during development from embryo day 13 to adulthood while, in the spleen, levels remain constant throughout development.
Gene expression databases
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 23-26 | Endocytosis signal | ||||
Sequence: YRRV |
Sequence similarities
Belongs to the peptidase M28 family. M28B subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q9JKX3-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length798
- Mass (Da)88,402
- Last updated2002-02-11 v2
- ChecksumFA6161FE3FFF2AA4
Q9JKX3-2
- Name2
- NoteLacks most of the extracellular domain.
Q9JKX3-3
- Name3
- Differences from canonical
- 12-93: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0G2JED7 | A0A0G2JED7_MOUSE | Tfr2 | 123 |
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_005356 | 12-93 | in isoform 3 | |||
Sequence: Missing | ||||||
Sequence conflict | 25 | in Ref. 2; AAL05977 | ||||
Sequence: R → P | ||||||
Sequence conflict | 42 | in Ref. 2; AAL05977 and 5; AAK28830 | ||||
Sequence: G → V | ||||||
Sequence conflict | 103 | in Ref. 2; AAL05977 | ||||
Sequence: R → P | ||||||
Sequence conflict | 151 | in Ref. 4; AAH13654 | ||||
Sequence: T → N | ||||||
Alternative sequence | VSP_005357 | 237 | in isoform 2 | |||
Sequence: T → TVRFPGWGAHHVLIG | ||||||
Alternative sequence | VSP_005358 | 238-798 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 248 | in Ref. 2; AAL05976 | ||||
Sequence: S → L | ||||||
Sequence conflict | 287 | in Ref. 2; AAL05976 | ||||
Sequence: A → V | ||||||
Sequence conflict | 595 | in Ref. 1; AAF37272 | ||||
Sequence: K → E |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF222895 EMBL· GenBank· DDBJ | AAF37272.1 EMBL· GenBank· DDBJ | mRNA | ||
AF207741 EMBL· GenBank· DDBJ | AAL05976.1 EMBL· GenBank· DDBJ | mRNA | ||
AF207742 EMBL· GenBank· DDBJ | AAL05977.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK004965 EMBL· GenBank· DDBJ | BAB23705.1 EMBL· GenBank· DDBJ | mRNA | ||
AK004848 EMBL· GenBank· DDBJ | BAB23614.1 EMBL· GenBank· DDBJ | mRNA | ||
BC013654 EMBL· GenBank· DDBJ | AAH13654.1 EMBL· GenBank· DDBJ | mRNA | ||
AF312033 EMBL· GenBank· DDBJ | AAK28830.1 EMBL· GenBank· DDBJ | Genomic DNA |