Q9JKN5 · OLIG1_MOUSE
- ProteinOligodendrocyte transcription factor 1
- GeneOlig1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids260 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Cellular Component | transcription regulator complex | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | E-box binding | |
Molecular Function | protein dimerization activity | |
Biological Process | axon development | |
Biological Process | neuron fate commitment | |
Biological Process | oligodendrocyte development | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | sensory organ development |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameOligodendrocyte transcription factor 1
- Short namesOligo1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9JKN5
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000127412 | 1-260 | Oligodendrocyte transcription factor 1 | |||
Sequence: MYYAISQARVNAAPATMLRPQRPGDVQLGASLYELVGYRQPPISSSSSSSSSTASLLPKPAREKAEAPLAEPRGPAPESGGARADAKEEQQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGDGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPETLRPTKYLSLALDEPPCGQFSLPAGGAGSPGLCSCAVCKFPHLVPAGLGLAAVQAQFSK |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed specifically in brain.
Induction
By SHH.
Developmental stage
Expressed in the ventral spinal cord as early as 9.5 dpc. Expression declines to undetectable levels by 10.5 dpc and reappears in a narrow zone within the ventral neuroepithelium of the spinal cord. In the 14.5 dpc spinal cord, expressed in the oligodendrocyte progenitors of the ventral ventricular zone, but not dorsal root ganglia Schwann cells. Also expressed scattered in the mantle zone, likely corresponding to oligodendrocyte progenitors migrating out from their site of origin. By 15.5 dpc, dispersed throughout the gray matter, with little or no residual expression in the ventricular zone. In the postnatal brain, present preferentially in the white matter, such as corpus callosum and cerebellar medulla. Expressed in the olfactory epithelium from 11.5dpc onward.
Gene expression databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9JKN5 | Id2 P41136 | 5 | EBI-1213712, EBI-309167 | |
BINARY | Q9JKN5 | Id4 P41139 | 5 | EBI-1213712, EBI-1213725 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 42-57 | Polar residues | ||||
Sequence: PISSSSSSSSSTASLL | ||||||
Region | 42-104 | Disordered | ||||
Sequence: PISSSSSSSSSTASLLPKPAREKAEAPLAEPRGPAPESGGARADAKEEQQQQQLRRKINSRER | ||||||
Compositional bias | 82-104 | Basic and acidic residues | ||||
Sequence: ARADAKEEQQQQQLRRKINSRER | ||||||
Domain | 94-153 | bHLH | ||||
Sequence: QLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLL |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length260
- Mass (Da)27,141
- Last updated2002-08-30 v2
- Checksum5EA8A74D9DF0D310
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 42-57 | Polar residues | ||||
Sequence: PISSSSSSSSSTASLL | ||||||
Compositional bias | 82-104 | Basic and acidic residues | ||||
Sequence: ARADAKEEQQQQQLRRKINSRER |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB038696 EMBL· GenBank· DDBJ | BAB18906.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
BC046316 EMBL· GenBank· DDBJ | AAH46316.1 EMBL· GenBank· DDBJ | mRNA | ||
AF232928 EMBL· GenBank· DDBJ | AAF61721.1 EMBL· GenBank· DDBJ | Genomic DNA |