Q9JK83 · PAR6B_MOUSE
- ProteinPartitioning defective 6 homolog beta
- GenePard6b
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids371 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Adapter protein involved in asymmetrical cell division and cell polarization processes. Probably involved in formation of epithelial tight junctions. Association with PARD3 may prevent the interaction of PARD3 with F11R/JAM1, thereby preventing tight junction assembly. The PARD6-PARD3 complex links GTP-bound Rho small GTPases to atypical protein kinase C proteins.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apical part of cell | |
Cellular Component | apical plasma membrane | |
Cellular Component | bicellular tight junction | |
Cellular Component | cell cortex | |
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Cellular Component | plasma membrane | |
Cellular Component | protein-containing complex | |
Biological Process | cell division | |
Biological Process | centrosome cycle | |
Biological Process | establishment or maintenance of cell polarity | |
Biological Process | protein-containing complex assembly | |
Biological Process | regulation of cellular localization |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePartitioning defective 6 homolog beta
- Short namesPAR-6 beta; PAR-6B
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9JK83
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Colocalizes with active form of CDC42 or RAC1 at membrane ruffles. Also localizes to tight junctions.
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 133-134 | Does not abolish interaction with CDC42 and RHOQ. | ||||
Sequence: IS → AA | ||||||
Mutagenesis | 136 | Abolishes interaction with RHOQ, but not the interaction with CDC42; when associated with A-139. | ||||
Sequence: P → A | ||||||
Mutagenesis | 139 | Abolishes interaction with RHOQ, but not the interaction with CDC42; when associated with A-136. | ||||
Sequence: F → A | ||||||
Mutagenesis | 167-170 | Strongly reduces interaction with PARD3. Does not abolish interaction with CDC42 and RHOQ. | ||||
Sequence: KPLG → AAAA | ||||||
Mutagenesis | 235 | Prevents interaction with PALS1. | ||||
Sequence: M → W |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 15 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000112517 | 1-371 | Partitioning defective 6 homolog beta | |||
Sequence: MNRGHRHGASSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIRKKNMLSNVLRPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRNNVVRNSRTSGSSSQSTDNSLLGFPQQVEASFEPEDQDSDEDDIIIEDSGEPQQIPKATPAQSLESLTQIELSFESGQNGFSPPQDTSLVPVPGSLDTELESRAPDQKLLEEDGTIITL | ||||||
Modified residue | 10 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 11 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in pancreas and in both adult and fetal kidney. Weakly expressed in placenta and lung. Not expressed in other tissues.
Gene expression databases
Interaction
Subunit
Interacts with PARD3. Interacts with GTP-bound forms of CDC42, RHOQ/TC10 and RAC1. Interacts with the N-terminal part of PRKCI and PRKCZ. Part of a complex with PARD3, CDC42 or RAC1 and PRKCI or PRKCZ. Part of a complex with LLGL1 and PRKCI. Interacts with ALS2CR19. Interacts with ECT2 (By similarity).
Interacts with PALS1
Interacts with PALS1
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
XENO | Q9JK83 | CDC42 P60953 | 6 | EBI-81861, EBI-81752 | |
XENO | Q9JK83 | PARD3 Q8TEW0 | 3 | EBI-81861, EBI-81968 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 16-96 | PB1 | ||||
Sequence: TMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKK | ||||||
Region | 126-253 | Interaction with PARD3 and CDC42 | ||||
Sequence: RKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN | ||||||
Domain | 133-150 | Pseudo-CRIB | ||||
Sequence: ISMPQDFRPVSSIIDVDI | ||||||
Domain | 157-250 | PDZ | ||||
Sequence: RVRLYKYGTEKPLGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPAN | ||||||
Region | 253-273 | Disordered | ||||
Sequence: NNVVRNSRTSGSSSQSTDNSL | ||||||
Compositional bias | 326-344 | Polar residues | ||||
Sequence: FESGQNGFSPPQDTSLVPV | ||||||
Region | 326-371 | Disordered | ||||
Sequence: FESGQNGFSPPQDTSLVPVPGSLDTELESRAPDQKLLEEDGTIITL |
Domain
The pseudo-CRIB domain together with the PDZ domain is required for the interaction with Rho small GTPases.
The PDZ domain mediates the interaction with PALS1.
Sequence similarities
Belongs to the PAR6 family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9JK83-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length371
- Mass (Da)41,067
- Last updated2011-07-27 v2
- Checksum664C7D25262494A9
Q9JK83-2
- Name2
Features
Showing features for sequence conflict, alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 13 | in Ref. 4; AAH25147 | ||||
Sequence: C → W | ||||||
Sequence conflict | 70 | in Ref. 1; AAF71528 | ||||
Sequence: L → P | ||||||
Sequence conflict | 161 | in Ref. 1; AAF71528 | ||||
Sequence: Y → C | ||||||
Alternative sequence | VSP_007460 | 298 | in isoform 2 | |||
Sequence: I → C | ||||||
Alternative sequence | VSP_007461 | 299-371 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 326-344 | Polar residues | ||||
Sequence: FESGQNGFSPPQDTSLVPV |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF252291 EMBL· GenBank· DDBJ | AAF71528.1 EMBL· GenBank· DDBJ | mRNA | ||
AL831766 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH466551 EMBL· GenBank· DDBJ | EDL06536.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC025147 EMBL· GenBank· DDBJ | AAH25147.1 EMBL· GenBank· DDBJ | mRNA |