Q9JK24 · P2R3C_MOUSE
- ProteinSerine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma
- GenePpp2r3c
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids453 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May regulate MCM3AP phosphorylation through phosphatase recruitment (PubMed:12167160).
May act as a negative regulator of ABCB1 expression and function through the dephosphorylation of ABCB1 by TFPI2/PPP2R3C complex (By similarity).
May play a role in the activation-induced cell death of B-cells (PubMed:16129705, PubMed:16343422).
May act as a negative regulator of ABCB1 expression and function through the dephosphorylation of ABCB1 by TFPI2/PPP2R3C complex (By similarity).
May play a role in the activation-induced cell death of B-cells (PubMed:16129705, PubMed:16343422).
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | centrosome | |
Cellular Component | cytosol | |
Cellular Component | Golgi apparatus | |
Cellular Component | nucleoplasm | |
Molecular Function | metal ion binding | |
Biological Process | B cell homeostasis | |
Biological Process | cortical cytoskeleton organization | |
Biological Process | microtubule cytoskeleton organization | |
Biological Process | positive regulation of B cell differentiation | |
Biological Process | regulation of antimicrobial humoral response | |
Biological Process | regulation of B cell activation | |
Biological Process | regulation of dephosphorylation | |
Biological Process | regulation of mitochondrial depolarization | |
Biological Process | spleen development | |
Biological Process | T cell homeostasis |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameSerine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9JK24
- Secondary accessions
Proteomes
Organism-specific databases
Phenotypes & Variants
Disruption phenotype
Mice display a reduction in the number of mature B-cells and an impaired B-cell proliferation upon B-Cell receptor cross-linking probably due to a loss of inhibition of BCR-induced apoptosis. PPP2R3C overexpression protects B-cells from activation-induced cell death.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 17 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000277834 | 1-453 | Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma | |||
Sequence: MDWKDVLRRRLASPNTDPKRKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQIPPMIGEEAMINYENFLKVGEKAGPKCKQFFTAKVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLYDVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKIQDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSRYGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDIENKGYLNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTVTTILIDLNGFWTYENREALVANDNENSADLDDT |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in all tissues tested including heart, brain, spleen, thymus, lung, liver, kidney and testis.
Induction
Up-regulated upon B-cell receptor cross-linking.
Developmental stage
Detected from 6 to 12 dpc in whole embryos and from 14 to 18 dpc in the heads of the embryos. Expressed in central nervous system, spine, face, pharynx, limbs and viscera at 11 dpc.
Gene expression databases
Interaction
Subunit
Interacts with MCM3AP/GANP, PPP5C, and the phosphatase 2A core enzyme composed of the PPP2CA catalytic subunit and the constant regulatory subunit PPP2R1A. Finds in a complex with ABCB1, TFPI2 and PPP2R3C; leading to the dephosphorylation of ABCB1.
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 273-308 | EF-hand 1 | ||||
Sequence: PSALRVYGQYLNLDKDHNGMLSKEELSRYGTATMTN | ||||||
Domain | 341-376 | EF-hand 2 | ||||
Sequence: KEPAALQYIFKLLDIENKGYLNVFSLNYFFRAIQEL |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length453
- Mass (Da)53,407
- Last updated2001-03-01 v2
- Checksum8FD29927385EAD81
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 335 | in Ref. 2; BAA95061 | ||||
Sequence: L → P |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ238247 EMBL· GenBank· DDBJ | CAB88038.2 EMBL· GenBank· DDBJ | mRNA | ||
AB041577 EMBL· GenBank· DDBJ | BAA95061.1 EMBL· GenBank· DDBJ | mRNA | ||
AK013403 EMBL· GenBank· DDBJ | BAB28835.1 EMBL· GenBank· DDBJ | mRNA | ||
AK028254 EMBL· GenBank· DDBJ | BAC25845.1 EMBL· GenBank· DDBJ | mRNA | ||
AK040589 EMBL· GenBank· DDBJ | BAC30637.1 EMBL· GenBank· DDBJ | mRNA | ||
AK087572 EMBL· GenBank· DDBJ | BAC39933.1 EMBL· GenBank· DDBJ | mRNA | ||
AK088240 EMBL· GenBank· DDBJ | BAC40229.1 EMBL· GenBank· DDBJ | mRNA | ||
BC024754 EMBL· GenBank· DDBJ | AAH24754.1 EMBL· GenBank· DDBJ | mRNA | ||
BC138295 EMBL· GenBank· DDBJ | AAI38296.1 EMBL· GenBank· DDBJ | mRNA | ||
BC138296 EMBL· GenBank· DDBJ | AAI38297.1 EMBL· GenBank· DDBJ | mRNA |