Q9JJA7 · CCNL2_MOUSE
- ProteinCyclin-L2
- GeneCcnl2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids518 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in pre-mRNA splicing. May induce cell death, possibly by acting on the transcription and RNA processing of apoptosis-related factors.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cyclin-dependent protein kinase holoenzyme complex | |
Cellular Component | nuclear speck | |
Cellular Component | nucleus | |
Molecular Function | cyclin-dependent protein serine/threonine kinase regulator activity | |
Biological Process | regulation of apoptotic process | |
Biological Process | regulation of cell cycle | |
Biological Process | regulation of centrosome cycle | |
Biological Process | regulation of RNA splicing | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameCyclin-L2
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9JJA7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000080488 | 1-518 | Cyclin-L2 | |||
Sequence: MAAAAAGAAGLMAPASAACSSGSAGAAPGSQGVLIGDRLYSGVLITLENCLLPDDKLRFTPSMSSGLDVDTETGLRVVGCELIQAAGILLRLPQVAMATGQVLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRRIRDVINVFHRLRHLREKKKPVPLVLDQEYVNLKNQIIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECERNQHLVQTAWNYMNDSLRTDVFVRFQPESIACACIYLAARTLEIPLPNRPHWFLLFGATEEEIQEICFKILQLYTRKKVDLTHLESEVEKRKHAIEEAKARAKGLLPGTAPGLDSAAGFSPAPKLESPKEGKGGKPSPPSGKSAKRKMEGPKKAQGHSPVNGLLKGQESRSQSRSREQSYSRSPSRSASPKRRKSDSGSTSGGSKSQSRSRSRSDSPPRQVHRGAPYKGSEVRGSRKSKDCKYLTQKPHKSRSRSSSRSRSRSRERTDNSGKYKKKSHYYRDQRRERSRSYERTGHRYERDHPGHSRHRR | ||||||
Modified residue | 328 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 335 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 345 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 348 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 366 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with CDK11A, CDK11B, CDK12, CDK13 and POLR2A, the hyperphosphorylated C-terminal domain (CTD) of RNA polymerase II. May form a ternary complex with CDK11B and casein kinase II (CKII). Interacts with pre-mRNA-splicing factors, including at least SRSF1, SRSF2 and SRSF7/SLU7.
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 81-183 | Cyclin-like 1 | ||||
Sequence: ELIQAAGILLRLPQVAMATGQVLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRRIRDVINVFHRLRHLREKKKPVPLVLDQEYVNLKNQIIKAERRVLK | ||||||
Region | 196-280 | Cyclin-like 2 | ||||
Sequence: KIIVMYLQVLECERNQHLVQTAWNYMNDSLRTDVFVRFQPESIACACIYLAARTLEIPLPNRPHWFLLFGATEEEIQEICFKILQ | ||||||
Region | 310-518 | Disordered | ||||
Sequence: AKGLLPGTAPGLDSAAGFSPAPKLESPKEGKGGKPSPPSGKSAKRKMEGPKKAQGHSPVNGLLKGQESRSQSRSREQSYSRSPSRSASPKRRKSDSGSTSGGSKSQSRSRSRSDSPPRQVHRGAPYKGSEVRGSRKSKDCKYLTQKPHKSRSRSSSRSRSRSRERTDNSGKYKKKSHYYRDQRRERSRSYERTGHRYERDHPGHSRHRR | ||||||
Compositional bias | 370-394 | Polar residues | ||||
Sequence: GLLKGQESRSQSRSREQSYSRSPSR | ||||||
Region | 382-420 | RS | ||||
Sequence: RSREQSYSRSPSRSASPKRRKSDSGSTSGGSKSQSRSRS | ||||||
Compositional bias | 402-422 | Polar residues | ||||
Sequence: KSDSGSTSGGSKSQSRSRSRS | ||||||
Compositional bias | 437-455 | Basic and acidic residues | ||||
Sequence: GSEVRGSRKSKDCKYLTQK | ||||||
Compositional bias | 466-484 | Basic and acidic residues | ||||
Sequence: RSRSRSRERTDNSGKYKKK | ||||||
Compositional bias | 491-509 | Basic and acidic residues | ||||
Sequence: QRRERSRSYERTGHRYERD |
Domain
Contains a RS region (arginine-serine dipeptide repeat) within the C-terminal domain which is the hallmark of the SR family of splicing factors. This region probably plays a role in protein-protein interactions (By similarity).
Sequence similarities
Belongs to the cyclin family. Cyclin L subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q9JJA7-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length518
- Mass (Da)58,005
- Last updated2000-10-01 v1
- ChecksumC93AEE68682CDBA5
Q9JJA7-2
- Name2
- NoteMay be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Q9JJA7-3
- Name3
- Differences from canonical
- 219-518: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F6RXL0 | F6RXL0_MOUSE | Ccnl2 | 93 |
Sequence caution
Features
Showing features for sequence conflict, alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 16 | in Ref. 4; BAE41413/BAE33556, 6; EDL15040 and 7; AAI32296 | ||||
Sequence: S → A | ||||||
Sequence conflict | 131 | in Ref. 4; BAC26255 | ||||
Sequence: K → R | ||||||
Alternative sequence | VSP_016134 | 219-224 | in isoform 2 | |||
Sequence: NYMNDS → VASEGK | ||||||
Alternative sequence | VSP_016133 | 219-518 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_016135 | 225-518 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 282 | in Ref. 7; AAH03773 | ||||
Sequence: Y → F | ||||||
Sequence conflict | 317 | in Ref. 6; EDL15040 and 7; AAH03773/AAI32296 | ||||
Sequence: T → S | ||||||
Sequence conflict | 334 | in Ref. 7; AAH03773/AAH83055 and 8; AAC52504 | ||||
Sequence: E → VE | ||||||
Compositional bias | 370-394 | Polar residues | ||||
Sequence: GLLKGQESRSQSRSREQSYSRSPSR | ||||||
Compositional bias | 402-422 | Polar residues | ||||
Sequence: KSDSGSTSGGSKSQSRSRSRS | ||||||
Compositional bias | 437-455 | Basic and acidic residues | ||||
Sequence: GSEVRGSRKSKDCKYLTQK | ||||||
Compositional bias | 466-484 | Basic and acidic residues | ||||
Sequence: RSRSRSRERTDNSGKYKKK | ||||||
Compositional bias | 491-509 | Basic and acidic residues | ||||
Sequence: QRRERSRSYERTGHRYERD |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF211859 EMBL· GenBank· DDBJ | AAF23011.1 EMBL· GenBank· DDBJ | mRNA | ||
AY337018 EMBL· GenBank· DDBJ | AAQ01205.1 EMBL· GenBank· DDBJ | mRNA | ||
AB041605 EMBL· GenBank· DDBJ | BAA95088.1 EMBL· GenBank· DDBJ | mRNA | ||
AK007552 EMBL· GenBank· DDBJ | BAB25103.1 EMBL· GenBank· DDBJ | mRNA | ||
AK029033 EMBL· GenBank· DDBJ | BAC26255.1 EMBL· GenBank· DDBJ | mRNA | ||
AK048244 EMBL· GenBank· DDBJ | BAE43334.1 EMBL· GenBank· DDBJ | mRNA | ||
AK156037 EMBL· GenBank· DDBJ | BAE33556.1 EMBL· GenBank· DDBJ | mRNA | ||
AK169857 EMBL· GenBank· DDBJ | BAE41413.1 EMBL· GenBank· DDBJ | mRNA | ||
AL670236 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH466594 EMBL· GenBank· DDBJ | EDL15040.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC003773 EMBL· GenBank· DDBJ | AAH03773.2 EMBL· GenBank· DDBJ | mRNA | ||
BC023747 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
BC083055 EMBL· GenBank· DDBJ | AAH83055.1 EMBL· GenBank· DDBJ | mRNA | ||
BC132295 EMBL· GenBank· DDBJ | AAI32296.1 EMBL· GenBank· DDBJ | mRNA | ||
U37351 EMBL· GenBank· DDBJ | AAC52504.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |