Q9JJ80 · RPF2_MOUSE
- ProteinRibosome production factor 2 homolog
- GeneRpf2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids306 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Involved in ribosomal large subunit assembly. May regulate the localization of the 5S RNP/5S ribonucleoprotein particle to the nucleolus.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromosome | |
Cellular Component | nucleolus | |
Cellular Component | nucleoplasm | |
Molecular Function | 5S rRNA binding | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Biological Process | maturation of LSU-rRNA | |
Biological Process | protein localization to nucleolus | |
Biological Process | regulation of signal transduction by p53 class mediator | |
Biological Process | ribosomal large subunit assembly | |
Biological Process | ribosomal large subunit biogenesis |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameRibosome production factor 2 homolog
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9JJ80
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Associated with the nucleolus in an RNA-dependent manner.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000120224 | 1-306 | Ribosome production factor 2 homolog | |||
Sequence: MDALDKVLKPKTKRAKRFLEKREPKLTENIKNAMLIKGGNANATVTQVLRDMYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIEKFVSLKDIKTSKCPEGTKPMLIFAGDDFDVTEDFRRLKNLLIDFFRGPTVSNVRLAGLEYVLHFTALNGKVYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVMRRTHLASDDLYKLSMKVPKALKPKKRKNISQDTFGTTFGRIHMQKQDLSKLQTRKMKGLKKRPAENGVDDQGKKSKRIKKN |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 31-234 | Brix | ||||
Sequence: KNAMLIKGGNANATVTQVLRDMYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIEKFVSLKDIKTSKCPEGTKPMLIFAGDDFDVTEDFRRLKNLLIDFFRGPTVSNVRLAGLEYVLHFTALNGKVYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVMRRTHLASDD | ||||||
Region | 270-306 | Disordered | ||||
Sequence: KQDLSKLQTRKMKGLKKRPAENGVDDQGKKSKRIKKN | ||||||
Compositional bias | 272-300 | Basic and acidic residues | ||||
Sequence: DLSKLQTRKMKGLKKRPAENGVDDQGKKS |
Sequence similarities
Belongs to the RPF2 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length306
- Mass (Da)35,364
- Last updated2001-09-26 v2
- ChecksumCF732DBD515794AB
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 8 | in Ref. 1; BAA95117 | ||||
Sequence: L → R | ||||||
Sequence conflict | 79 | in Ref. 2; BAB28829 | ||||
Sequence: E → G | ||||||
Compositional bias | 272-300 | Basic and acidic residues | ||||
Sequence: DLSKLQTRKMKGLKKRPAENGVDDQGKKS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB041810 EMBL· GenBank· DDBJ | BAA95117.1 EMBL· GenBank· DDBJ | mRNA | ||
AK010776 EMBL· GenBank· DDBJ | BAB27175.1 EMBL· GenBank· DDBJ | mRNA | ||
AK011644 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
AK012188 EMBL· GenBank· DDBJ | BAB28087.1 EMBL· GenBank· DDBJ | mRNA | ||
AK012641 EMBL· GenBank· DDBJ | BAB28375.1 EMBL· GenBank· DDBJ | mRNA | ||
AK013395 EMBL· GenBank· DDBJ | BAB28829.1 EMBL· GenBank· DDBJ | mRNA | ||
AK017678 EMBL· GenBank· DDBJ | BAB30868.1 EMBL· GenBank· DDBJ | mRNA | ||
AK020030 EMBL· GenBank· DDBJ | BAB31973.1 EMBL· GenBank· DDBJ | mRNA |