Q9IKC7 · VME1_CVRSD
- ProteinMembrane protein
- GeneM
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids228 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Component of the viral envelope that plays a central role in virus morphogenesis and assembly via its interactions with other viral proteins.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell Golgi membrane | |
Cellular Component | membrane | |
Cellular Component | viral envelope | |
Cellular Component | virion membrane | |
Molecular Function | structural constituent of virion | |
Biological Process | virus-mediated perturbation of host defense response |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameMembrane protein
- Short namesM protein
- Alternative names
Gene names
Organism names
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Pisuviricota > Pisoniviricetes > Nidovirales > Cornidovirineae > Coronaviridae > Orthocoronavirinae > Betacoronavirus > Embecovirus > Murine coronavirus
- Virus hosts
Accessions
- Primary accessionQ9IKC7
Subcellular Location
UniProt Annotation
GO Annotation
Virion membrane ; Multi-pass membrane protein
Host Golgi apparatus membrane ; Multi-pass membrane protein
Note: Largely embedded in the lipid bilayer.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 2-25 | Virion surface | ||||
Sequence: SSTTPAPQTVYQWTADVAVRFLKE | ||||||
Transmembrane | 26-46 | Helical | ||||
Sequence: WNFLLGIILLFITIILQFGYT | ||||||
Topological domain | 47-56 | Intravirion | ||||
Sequence: SRSMFIYVVK | ||||||
Transmembrane | 57-77 | Helical | ||||
Sequence: MIILWLMWPLTIVLCIFNCVY | ||||||
Topological domain | 78-85 | Virion surface | ||||
Sequence: ALNNVYLG | ||||||
Transmembrane | 86-106 | Helical | ||||
Sequence: FSIVFTIVSIVMWIMYFVNSI | ||||||
Topological domain | 107-228 | Intravirion | ||||
Sequence: RLFIRTGSWWSFNPETNNLMCIDVKGTVYVRPIIEDYHTLTATNVRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGVSGFAVYVKSKVGNYRLPSNKPSGADTALLRI |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000106044 | 1-228 | Membrane protein | |||
Sequence: MSSTTPAPQTVYQWTADVAVRFLKEWNFLLGIILLFITIILQFGYTSRSMFIYVVKMIILWLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVMWIMYFVNSIRLFIRTGSWWSFNPETNNLMCIDVKGTVYVRPIIEDYHTLTATNVRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTYKRAFLDKVDGVSGFAVYVKSKVGNYRLPSNKPSGADTALLRI |
Keywords
- PTM
Interaction
Subunit
Homomultimer. Interacts with envelope E protein in the budding compartment of the host cell, which is located between endoplasmic reticulum and the Golgi complex. Forms a complex with HE and S proteins. Interacts with nucleocapsid N protein. This interaction probably participates in RNA packaging into the virus.
Sequence
- Sequence statusComplete
- Length228
- Mass (Da)25,996
- Last updated2000-10-01 v1
- Checksum0AB2D8998F37EAB0