Q9HI21 · GVPF1_HALSA
- ProteinGas vesicle protein F1
- GenegvpF11; gvpF1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids213 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Might be involved in preventing aggregation of GvpA1 (Probable) (PubMed:33281806).
Proteins GvpF to GvpM might be involved in nucleating gas vesicle formation (Probable) (PubMed:15126480, PubMed:33281806).
A minor component of the gas vesicle, also found in soluble extracts (PubMed:15126480).
Gas vesicles are hollow, gas filled proteinaceous nanostructures found in several microbial planktonic microorganisms. They allow positioning of halobacteria at the optimal depth for growth in the poorly aerated, shallow brine pools of their habitat (PubMed:33711860).
Proteins GvpF to GvpM might be involved in nucleating gas vesicle formation (Probable) (PubMed:15126480, PubMed:33281806).
A minor component of the gas vesicle, also found in soluble extracts (PubMed:15126480).
Gas vesicles are hollow, gas filled proteinaceous nanostructures found in several microbial planktonic microorganisms. They allow positioning of halobacteria at the optimal depth for growth in the poorly aerated, shallow brine pools of their habitat (PubMed:33711860).
Expression of a 9.5 kb p-vac DNA fragment containing 2 divergently transcribed regions (gvpD-gvpE-gvpF-gvpG-gvpH-gvpI-gvpJ-gvpK-gvpL-gvpM and gvpA-gvpC-gvpN-gvpO) allows H.volcanii to produce gas vesicles (PubMed:10894744, PubMed:1404376, PubMed:7651141).
A minimal gas vesicle can be made in H.volcanii by gvpA1-gvpO1 plus gvpF1-gvpG1-gvpJ1-gvpK1-gvpL1-gvpM1; lack of enough GvpJ1 prevents formation (PubMed:10894744).
The same region restores gas vesicle production in H.halobium without the p-vac locus (PubMed:1398080).
A minimal gas vesicle can be made in H.volcanii by gvpA1-gvpO1 plus gvpF1-gvpG1-gvpJ1-gvpK1-gvpL1-gvpM1; lack of enough GvpJ1 prevents formation (PubMed:10894744).
The same region restores gas vesicle production in H.halobium without the p-vac locus (PubMed:1398080).
Miscellaneous
Encoded in a 14-gene plasmid locus called p-vac which produces predominantly short, spindle-shaped gas vesicles during all stages of growth.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | gas vesicle | |
Biological Process | gas vesicle organization |
Names & Taxonomy
Protein names
- Recommended nameGas vesicle protein F1
- Short namesGvpF
Gene names
Encoded on
- Plasmid pNRC100
- Plasmid pNRC200
- Plasmid pHH1
Organism names
- Strains
- Taxonomic lineageArchaea > Euryarchaeota > Stenosarchaea group > Halobacteria > Halobacteriales > Halobacteriaceae > Halobacterium > Halobacterium salinarum NRC-34001
Accessions
- Primary accessionQ9HI21
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Probably faces the interior of the gas vesicle.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
No gas vesicles are made, gvpA1 is still transcribed.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 3 | Small gas vesicles. | ||||
Sequence: E → A | ||||||
Mutagenesis | 14 | Long, thin gas vesicles. | ||||
Sequence: E → A | ||||||
Mutagenesis | 15 | Small gas vesicles. | ||||
Sequence: D → R | ||||||
Mutagenesis | 19 | Small gas vesicles. | ||||
Sequence: D → A or R | ||||||
Mutagenesis | 65 | Few, long, thin gas vesicles. | ||||
Sequence: E → A | ||||||
Mutagenesis | 71 | No gas vesicles. | ||||
Sequence: E → R | ||||||
Mutagenesis | 72 | No gas vesicles. | ||||
Sequence: E → A or R | ||||||
Mutagenesis | 213 | No gas vesicles. | ||||
Sequence: R → E |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000182681 | 1-213 | Gas vesicle protein F1 | |||
Sequence: MTENLYTYGIIEQEDLELDVEGVAGAEQVYTVDYKTLSAVVSDIDTTDPERTDEDVEAHNNVLQEVLKHEEERTVVPMSFGMAFKSARTLKGVLRGARRALRSTLNDIEGTVELGVKILGPGDDTVPREEIQENVTDQLADLSINETENDLFTDRLIINKSYLVDFEKRDAFDSAIDDVEAEYDELTIQYTGPWPPYNFVDIHIGAEQQQGGR |
Expression
Induction
Part of a gvpF1-gvpG1-gvpH1-gvpI1-gvpJ1-gvpK1-gvpL1-gvpM1 operon, maximally expressed in early to mid log phase (PubMed:1956294, PubMed:7651141).
Detected at very low levels in growing cells, at slightly higher levels in stationary phase (at protein level). Not detected in isolated gas vesicles (PubMed:7651141).
Gas vesicles appear earlier when grown in static culture, possibly due to O2-limitation (PubMed:33711860).
Detected at very low levels in growing cells, at slightly higher levels in stationary phase (at protein level). Not detected in isolated gas vesicles (PubMed:7651141).
Gas vesicles appear earlier when grown in static culture, possibly due to O2-limitation (PubMed:33711860).
Interaction
Subunit
Binds GvpA1 in early growth stages; is the only one of GvpF1 to GvpM1 that interacts with GvpA1 in H.volcanii experiments (PubMed:33281806, PubMed:34975818).
GvpF to GvpM interact with each other in vitro, and may form multi-subunit complex(es) (PubMed:33281806).
Interacts with GvpC1 and GvpO1 (PubMed:35966690).
GvpF to GvpM interact with each other in vitro, and may form multi-subunit complex(es) (PubMed:33281806).
Interacts with GvpC1 and GvpO1 (PubMed:35966690).
Structure
Family & Domains
Sequence similarities
Belongs to the gas vesicle GvpF/GvpL family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length213
- Mass (Da)23,962
- Last updated2001-01-11 v1
- ChecksumE0F1936705DB0326
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 31 | in Ref. 2; CAA39173 | ||||
Sequence: T → P |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M58557 EMBL· GenBank· DDBJ | AAA98193.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X55648 EMBL· GenBank· DDBJ | CAA39173.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF016485 EMBL· GenBank· DDBJ | AAC82806.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE004438 EMBL· GenBank· DDBJ | AAG20723.1 EMBL· GenBank· DDBJ | Genomic DNA |