Essential maintenance is planned to begin on Tue Jan 28 2025. The website may be temporarily unavailable. Please use our fallback: https://wwwdev.ebi.ac.uk/uniprot/front-end/fallback/ during this time.

Q9HDZ6 · DAM1_SCHPO

Function

function

Component of the DASH complex that connects microtubules with kinetochores and couples microtubule depolymerisation to chromosome movement; it is involved in retrieving kinetochores to the spindle poles before their re-orientation on the spindle in early mitosis and allows microtubule depolymerization to pull chromosomes apart and resist detachment during anaphase (PubMed:16079914, PubMed:20624975).
Kinetochores, consisting of a centromere-associated inner segment and a microtubule-contacting outer segment, play a crucial role in chromosome segregation by mediating the physical connection between centromeric DNA and microtubules (PubMed:16079914, PubMed:20624975).
Kinetochores also serve as an input point for the spindle assembly checkpoint, which delays anaphase until all chromosomes have bioriented on the mitotic spindle (PubMed:16079915).
The DASH complex mediates bipolar kinetochore-microtubule attachments and facilitates the formation of additional interactions between outer kinetochore components and spindle microtubules (PubMed:16079914, PubMed:16079915, PubMed:22375062).
During chromosome movement along the microtubule, it is required both for the sliding of kinetochores along the lateral side of the microtubule and also for microtubule end-on pulling on the kinetochore (PubMed:17881496, PubMed:18256284).
Modulates cytoplasmic microtubule dynamics by tracking the plus-end of shortening microtubules and slowing their depolymerization (PubMed:17881496, PubMed:20624975).

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentcondensed chromosome, centromeric region
Cellular Componentcortical microtubule
Cellular ComponentDASH complex
Cellular Componentkinetochore
Cellular Componentmitotic spindle
Cellular Componentmitotic spindle polar microtubule
Cellular Componentmitotic spindle pole body
Cellular Componentnucleus
Cellular Componentouter kinetochore
Biological Processattachment of mitotic spindle microtubules to kinetochore
Biological Processattachment of spindle microtubules to kinetochore
Biological Processcell division
Biological Processhomologous chromosome orientation in meiotic metaphase I
Biological Processmicrotubule depolymerization
Biological Processmitotic metaphase chromosome recapture
Biological Processmitotic sister chromatid biorientation
Biological Processmitotic spindle formation (spindle phase one)
Biological Processprotein transport along microtubule to mitotic spindle pole body
Biological Processrepair of kinetochore microtubule attachment defect
Biological Processspindle attachment to meiosis I kinetochore

Keywords

Names & Taxonomy

Protein names

  • Recommended name
    DASH complex subunit dam1
  • Alternative names
    • Outer kinetochore protein dam1

Gene names

    • Name
      dam1
    • ORF names
      SPAC589.08c

Organism names

Accessions

  • Primary accession
    Q9HDZ6

Proteomes

Organism-specific databases

Subcellular Location

Nucleus
Note: Associates with the mitotic spindle and the kinetochore. Kinetochore association occurs only during mitosis (PubMed:16079914).
During metaphase, localizes to the plus-ends of intranuclear microtubules (INMs) (PubMed:18256284).
In the cytoskeleton, localizes to cortical microtubules (PubMed:20624975).

Keywords

Phenotypes & Variants

Disruption phenotype

Leads to mitotic defects in a proportion of cells, including an increased time spent in metaphase, abnormal reattachment of chromosomes that have become detached from the spindle, lagging chromosomes, unequal chromosome segregation, and ultimately cut cells (septation without chromosome segregation) (PubMed:16079915, PubMed:17881496, PubMed:20624975).
Sensitive to thiabendazole, thermal stress, and osmotic stress (PubMed:16079915, PubMed:20624975).
Simultaneous disruption of klp6 or klp5 is lethal and leads to the cut phenotype (septation without chromosome segregation) (PubMed:16079915, PubMed:22375062).

Features

Showing features for mutagenesis.

TypeIDPosition(s)Description
Mutagenesis143Resistance to thiabendazole.

Variants

We now provide the "Disease & Variants" viewer in its own tab.

The viewer provides 1 variant from UniProt as well as other sources including ClinVar and dbSNP.

Go to variant viewer

PTM/Processing

Features

Showing features for chain, modified residue.

Type
IDPosition(s)Description
ChainPRO_00001276611-155DASH complex subunit dam1
Modified residue143Phosphoserine; by plo1

Post-translational modification

Phosphorylated by plo1 at Ser-143 during prometaphase and metaphase to promote chromosome biorientation (PubMed:22375062).
Dephosphorylated in anaphase (PubMed:22375062).

Keywords

Proteomic databases

PTM databases

Interaction

Subunit

Component of the DASH complex consisting of ask1, dad1, dad2, dad3, dad4, dam1, duo1, dad5, spc19 and spc34, with a stoichiometry of one copy of each subunit per complex (PubMed:16079914, PubMed:22375062).
Multiple DASH complexes oligomerize to form a ring that encircles spindle microtubules and organizes the rod-like NDC80 complexes of the outer kinetochore (By similarity).
DASH complex oligomerization strengthens microtubule attachments (By similarity).
On cytoplasmic microtubules, DASH complexes appear to form patches instead of rings (PubMed:20624975).
Integrity of the complex and interactions with central kinetochore proteins are regulated by the spindle assembly checkpoint kinase ark1 (PubMed:16079914).

Protein-protein interaction databases

Structure

Family & Domains

Sequence similarities

Belongs to the DASH complex DAM1 family.

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    155
  • Mass (Da)
    17,444
  • Last updated
    2001-03-01 v1
  • MD5 Checksum
    A3106C5DB5C1FD6C3D6D9307224E0885
MEKYQKATQNPLENVDNVKIESENAIPSNLQAFTKSLAVLDDNVSEFRKRMNHLSATKQILDNFNESFSSFLYGLQINAFCVDYENAPLSESFLLQAKKDQFKATLMTRTGHSISDPPYDGGVISHDPNFATADETFATNDTSFIERPETYSASR

Keywords

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
CU329670
EMBL· GenBank· DDBJ
CAC19765.1
EMBL· GenBank· DDBJ
Genomic DNA

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help