Q9HCQ7 · NPVF_HUMAN
- ProteinPro-FMRFamide-related neuropeptide VF
- GeneNPVF
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids196 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Neuropeptide RFRP-1
Efficiently inhibits forskolin-induced production of cAMP. Acts as a potent negative regulator of gonadotropin synthesis and secretion (PubMed:11025660, PubMed:20027225).
Induces secretion of prolactin (By similarity).
Induces secretion of prolactin (By similarity).
Neuropeptide NPVF
Efficiently inhibits forskolin-induced production of cAMP. Blocks morphine-induced analgesia.
Neuropeptide RFRP-2
Shows no inhibitory activity of forskolin-induced production of cAMP.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | signaling receptor binding | |
Biological Process | negative regulation of gonadotropin secretion | |
Biological Process | neuropeptide signaling pathway |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePro-FMRFamide-related neuropeptide VF
- Cleaved into 4 chains
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9HCQ7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_014073 | 32 | in dbSNP:rs886354 | |||
Sequence: M → I | ||||||
Natural variant | VAR_014074 | 42 | in dbSNP:rs877834 | |||
Sequence: D → G | ||||||
Natural variant | VAR_030644 | 121 | in dbSNP:rs3213641 | |||
Sequence: V → M |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 281 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, propeptide, peptide, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-26 | |||||
Sequence: MEIISSKLFILLTLATSSLLTSNIFC | ||||||
Propeptide | PRO_0000009920 | 27-55 | ||||
Sequence: ADELVMSNLHSKENYDKYSEPRGYPKGER | ||||||
Peptide | PRO_0000009921 | 56-92 | Neuropeptide NPSF | |||
Sequence: SLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRF | ||||||
Peptide | PRO_0000401171 | 81-92 | Neuropeptide RFRP-1 | |||
Sequence: MPHSFANLPLRF | ||||||
Modified residue | 92 | Phenylalanine amide | ||||
Sequence: F | ||||||
Propeptide | PRO_0000009922 | 95-99 | ||||
Sequence: NVQEE | ||||||
Peptide | PRO_0000009923 | 101-112 | Neuropeptide RFRP-2 | |||
Sequence: SAGATANLPLRS | ||||||
Propeptide | PRO_0000009924 | 115-121 | ||||
Sequence: NMEVSLV | ||||||
Peptide | PRO_0000009925 | 124-131 | Neuropeptide NPVF | |||
Sequence: VPNLPQRF | ||||||
Modified residue | 131 | Phenylalanine amide | ||||
Sequence: F | ||||||
Propeptide | PRO_0000009926 | 134-196 | ||||
Sequence: TTTAKSVCRMLSDLCQGSMHSPCANDLFYSMTCQHQEIQNPDQKQSRRLLFKKIDDAELKQEK |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Isoform 1
Specifically expressed in the retina.
Neuropeptide RFRP-1
Detected in the hypothalamus.
Neuropeptide NPVF
Detected in the hypothalamus.
Gene expression databases
Organism-specific databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9HCQ7 | SGTA O43765 | 3 | EBI-1753111, EBI-347996 | |
BINARY | Q9HCQ7 | UBQLN2 Q9UHD9 | 3 | EBI-1753111, EBI-947187 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q9HCQ7-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length196
- Mass (Da)22,327
- Last updated2022-02-23 v3
- Checksum332248B927702198
Q9HCQ7-2
- Name2
- Differences from canonical
- 181-196: Missing
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_039962 | 181-196 | in isoform 2 | |||
Sequence: Missing |
Mass Spectrometry
Neuropeptide RFRP-1
Molecular mass is 1,428.85 Da. Determined by MALDI.Neuropeptide NPVF
Molecular mass is 969.56 Da. Determined by MALDI.Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB040290 EMBL· GenBank· DDBJ | BAB17674.1 EMBL· GenBank· DDBJ | mRNA | ||
AF330057 EMBL· GenBank· DDBJ | AAK94201.1 EMBL· GenBank· DDBJ | mRNA | ||
AF440392 EMBL· GenBank· DDBJ | AAL90453.1 EMBL· GenBank· DDBJ | mRNA | ||
AF440395 EMBL· GenBank· DDBJ | AAL90458.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF440393 EMBL· GenBank· DDBJ | AAL90458.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF440394 EMBL· GenBank· DDBJ | AAL90458.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC004129 EMBL· GenBank· DDBJ | AAP22339.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH236948 EMBL· GenBank· DDBJ | EAL24237.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471073 EMBL· GenBank· DDBJ | EAW93830.1 EMBL· GenBank· DDBJ | Genomic DNA |