Q9HC23 · PROK2_HUMAN
- ProteinProkineticin-2
- GenePROK2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids129 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. May also function locally within the SCN to synchronize output. Potently contracts gastrointestinal (GI) smooth muscle.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | G protein-coupled receptor binding | |
Biological Process | angiogenesis | |
Biological Process | chemotaxis | |
Biological Process | circadian rhythm | |
Biological Process | endothelial cell proliferation | |
Biological Process | G protein-coupled receptor signaling pathway | |
Biological Process | inflammatory response | |
Biological Process | negative regulation of apoptotic process | |
Biological Process | neuropeptide signaling pathway | |
Biological Process | positive regulation of cytosolic calcium ion concentration | |
Biological Process | positive regulation of smooth muscle contraction | |
Biological Process | sensory perception of pain | |
Biological Process | spermatogenesis |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProkineticin-2
- Short namesPK2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9HC23
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Hypogonadotropic hypogonadism 4 with or without anosmia (HH4)
- Note
- DescriptionA disorder characterized by absent or incomplete sexual maturation by the age of 18 years, in conjunction with low levels of circulating gonadotropins and testosterone and no other abnormalities of the hypothalamic-pituitary axis. In some cases, it is associated with non-reproductive phenotypes, such as anosmia, cleft palate, and sensorineural hearing loss. Anosmia or hyposmia is related to the absence or hypoplasia of the olfactory bulbs and tracts. Hypogonadism is due to deficiency in gonadotropin-releasing hormone and probably results from a failure of embryonic migration of gonadotropin-releasing hormone-synthesizing neurons. In the presence of anosmia, idiopathic hypogonadotropic hypogonadism is referred to as Kallmann syndrome, whereas in the presence of a normal sense of smell, it has been termed normosmic idiopathic hypogonadotropic hypogonadism (nIHH).
- See alsoMIM:610628
Natural variants in HH4
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_069970 | 24 | A>P | in HH4; phenotype consistent with Kallmann syndrome; dbSNP:rs587777863 | |
VAR_030955 | 32 | G>R | in HH4; phenotype consistent with Kallmann syndrome; dbSNP:rs104893767 | |
VAR_072177 | 34 | C>Y | in HH4; totally abolished intracellular calcium mobilization; dbSNP:rs587777864 | |
VAR_072991 | 46 | C>Y | in HH4; dbSNP:rs1427017264 | |
VAR_072178 | 50 | I>M | in HH4; no effect on intracellular calcium mobilization; dbSNP:rs1388290870 | |
VAR_030956 | 73 | R>C | in HH4; phenotype consistent with Kallmann syndrome; impaired calcium mobilization; dbSNP:rs121434272 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_069970 | 24 | in HH4; phenotype consistent with Kallmann syndrome; dbSNP:rs587777863 | |||
Sequence: A → P | ||||||
Natural variant | VAR_030955 | 32 | in HH4; phenotype consistent with Kallmann syndrome; dbSNP:rs104893767 | |||
Sequence: G → R | ||||||
Natural variant | VAR_072177 | 34 | in HH4; totally abolished intracellular calcium mobilization; dbSNP:rs587777864 | |||
Sequence: C → Y | ||||||
Natural variant | VAR_072991 | 46 | in HH4; dbSNP:rs1427017264 | |||
Sequence: C → Y | ||||||
Natural variant | VAR_072178 | 50 | in HH4; no effect on intracellular calcium mobilization; dbSNP:rs1388290870 | |||
Sequence: I → M | ||||||
Natural variant | VAR_030956 | 73 | in HH4; phenotype consistent with Kallmann syndrome; impaired calcium mobilization; dbSNP:rs121434272 | |||
Sequence: R → C |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 161 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-27 | |||||
Sequence: MRSLCCAPLLLLLLLPPLLLTPRAGDA | ||||||
Chain | PRO_0000025809 | 28-129 | Prokineticin-2 | |||
Sequence: AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK | ||||||
Disulfide bond | 34↔46 | |||||
Sequence: CDKDSQCGGGMCC | ||||||
Disulfide bond | 40↔58 | |||||
Sequence: CGGGMCCAVSIWVKSIRIC | ||||||
Disulfide bond | 45↔107 | |||||
Sequence: CCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTC | ||||||
Disulfide bond | 68↔115 | |||||
Sequence: CHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLAC | ||||||
Disulfide bond | 109↔125 | |||||
Sequence: CLPGLACLRTSFNRFIC |
Keywords
- PTM
Proteomic databases
Expression
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9HC23 | TMBIM1 Q969X1 | 3 | EBI-13045372, EBI-2820569 |
Protein-protein interaction databases
Chemistry
Miscellaneous
Structure
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q9HC23-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length129
- Mass (Da)14,314
- Last updated2001-09-26 v2
- Checksum0487679E8700DA55
Q9HC23-2
- Name2
- Differences from canonical
- 75-95: Missing
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_005219 | 75-95 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF333025 EMBL· GenBank· DDBJ | AAK49919.1 EMBL· GenBank· DDBJ | mRNA | ||
AY349131 EMBL· GenBank· DDBJ | AAR06657.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471055 EMBL· GenBank· DDBJ | EAW65506.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC069395 EMBL· GenBank· DDBJ | AAH69395.1 EMBL· GenBank· DDBJ | mRNA | ||
BC096695 EMBL· GenBank· DDBJ | AAH96695.1 EMBL· GenBank· DDBJ | mRNA | ||
BC098110 EMBL· GenBank· DDBJ | AAH98110.1 EMBL· GenBank· DDBJ | mRNA | ||
BC098162 EMBL· GenBank· DDBJ | AAH98162.1 EMBL· GenBank· DDBJ | mRNA | ||
AF182069 EMBL· GenBank· DDBJ | AAG16893.2 EMBL· GenBank· DDBJ | mRNA |