Q9HAU5 · RENT2_HUMAN
- ProteinRegulator of nonsense transcripts 2
- GeneUPF2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1272 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by associating with the nuclear exon junction complex (EJC). Recruited by UPF3B associated with the EJC core at the cytoplasmic side of the nuclear envelope and the subsequent formation of an UPF1-UPF2-UPF3 surveillance complex (including UPF1 bound to release factors at the stalled ribosome) is believed to activate NMD. In cooperation with UPF3B stimulates both ATPase and RNA helicase activities of UPF1. Binds spliced mRNA.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytoplasmic ribonucleoprotein granule | |
Cellular Component | cytosol | |
Cellular Component | exon-exon junction complex | |
Cellular Component | nucleus | |
Cellular Component | perinuclear region of cytoplasm | |
Molecular Function | RNA binding | |
Molecular Function | telomeric DNA binding | |
Biological Process | animal organ regeneration | |
Biological Process | liver development | |
Biological Process | mRNA export from nucleus | |
Biological Process | nuclear-transcribed mRNA catabolic process, nonsense-mediated decay |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameRegulator of nonsense transcripts 2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9HAU5
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_024345 | 496 | in dbSNP:rs7079388 | |||
Sequence: N → S | ||||||
Mutagenesis | 796-797 | Strongly impairs RNA-binding. | ||||
Sequence: RK → EE | ||||||
Mutagenesis | 847 | Does not abolish interaction with UPF3B. | ||||
Sequence: D → K | ||||||
Mutagenesis | 851-852 | Does not abolish interaction with UPF3B. Does not abolish interaction with UPF3B; when associated with D-854. | ||||
Sequence: ED → KR | ||||||
Mutagenesis | 854 | Does not abolish interaction with UPF3B; when associated with K-851 and R-852. | ||||
Sequence: R → D | ||||||
Mutagenesis | 858 | Abolishes interaction with UPF3B and association with SMG1 and RBM8A; reduces phosphorylation of UPF1. | ||||
Sequence: E → R | ||||||
Mutagenesis | 894 | Does not impair RNA-binding; when associated with A-932. | ||||
Sequence: Y → A | ||||||
Mutagenesis | 932 | Does not impair RNA-binding; when associated with A-894. | ||||
Sequence: Y → A | ||||||
Mutagenesis | 1113 | Abolishes interaction with UPF1. | ||||
Sequence: F → E | ||||||
Mutagenesis | 1120 | Decreases interaction with UPF1; does not reduce NMD efficiency. | ||||
Sequence: M → E | ||||||
Mutagenesis | 1121 | Decreases interaction with UPF1; does not reduce NMD efficiency. | ||||
Sequence: M → E | ||||||
Mutagenesis | 1123 | Decreases interaction with UPF1. | ||||
Sequence: E → R | ||||||
Mutagenesis | 1169 | Decreases interaction with UPF1. | ||||
Sequence: M → E | ||||||
Mutagenesis | 1171 | Abolishes interaction with UPF1; reduces NMD efficiency. | ||||
Sequence: F → E | ||||||
Mutagenesis | 1171 | Greatly reduces NMD efficiency; when associated with E-1173 and E-1174. | ||||
Sequence: F → E | ||||||
Mutagenesis | 1173 | Abolishes interaction with UPF1. | ||||
Sequence: M → E | ||||||
Mutagenesis | 1173 | Greatly reduces NMD efficiency; when associated with E-1171 and E-1174. | ||||
Sequence: M → E | ||||||
Mutagenesis | 1174 | Abolishes interaction with UPF1; reduces NMD efficiency. | ||||
Sequence: L → E | ||||||
Mutagenesis | 1174 | Greatly reduces NMD efficiency; when associated with E-1171 and E-1173. | ||||
Sequence: L → E | ||||||
Mutagenesis | 1176 | Decreases interaction with UPF1. | ||||
Sequence: R → E |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,157 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000097248 | 1-1272 | UniProt | Regulator of nonsense transcripts 2 | |||
Sequence: MPAERKKPASMEEKDSLPNNKEKDCSERRTVSSKERPKDDIKLTAKKEVSKAPEDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQAKRQQEEEAAAQMKEKEESIQLHQEAWERHHLRKELRSKNQNAPDSRPEENFFSRLDSSLKKNTAFVKKLKTITEQQRDSLSHDFNGLNLSKYIAEAVASIVEAKLKISDVNCAVHLCSLFHQRYADFAPSLLQVWKKHFEARKEEKTPNITKLRTDLRFIAELTIVGIFTDKEGLSLIYEQLKNIINADRESHTHVSVVISFCRHCGDDIAGLVPRKVKSAAEKFNLSFPPSEIISPEKQQPFQNLLKEYFTSLTKHLKRDHRELQNTERQNRRILHSKGELSEDRHKQYEEFAMSYQKLLANSQSLADLLDENMPDLPQDKPTPEEHGPGIDIFTPGKPGEYDLEGGIWEDEDARNFYENLIDLKAFVPAILFKDNEKSCQNKESNKDDTKEAKESKENKEVSSPDDLELELENLEINDDTLELEGGDEAEDLTKKLLDEQEQEDEEASTGSHLKLIVDAFLQQLPNCVNRDLIDKAAMDFCMNMNTKANRKKLVRALFIVPRQRLDLLPFYARLVATLHPCMSDVAEDLCSMLRGDFRFHVRKKDQINIETKNKTVRFIGELTKFKMFTKNDTLHCLKMLLSDFSHHHIEMACTLLETCGRFLFRSPESHLRTSVLLEQMMRKKQAMHLDARYVTMVENAYYYCNPPPAEKTVKKKRPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVNDKDSKDSMTEGENLEEDEEEEEGGAETEEQSGNESEVNEPEEEEGSDNDDDEGEEEEEENTDYLTDSNKENETDEENTEVMIKGGGLKHVPCVEDEDFIQALDKMMLENLQQRSGESVKVHQLDVAIPLHLKSQLRKGPPLGGGEGEAESADTMPFVMLTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGGRRR | |||||||
Modified residue | 1088 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 1088 | PRIDE | Phosphothreonine | ||||
Sequence: T |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Found in a post-splicing messenger ribonucleoprotein (mRNP) complex. Associates with the exon junction complex (EJC). Interacts with SMG1, EST1A, UPF1, UPF3A, UPF3B, EIF4A1 and EIF1.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9HAU5 | PUF60 Q9UHX1 | 3 | EBI-372073, EBI-1053259 | |
BINARY | Q9HAU5 | SMG1 Q96Q15 | 7 | EBI-372073, EBI-1049832 | |
BINARY | Q9HAU5 | UPF1 Q92900 | 30 | EBI-372073, EBI-373471 | |
BINARY | Q9HAU5 | UPF1 Q92900-2 | 9 | EBI-372073, EBI-373492 | |
BINARY | Q9HAU5 | UPF3A Q9H1J1 | 5 | EBI-372073, EBI-521530 | |
BINARY | Q9HAU5 | UPF3B Q9BZI7 | 8 | EBI-372073, EBI-372780 | |
BINARY | Q9HAU5 | UPF3B Q9BZI7-2 | 7 | EBI-372073, EBI-15674130 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, coiled coil, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-126 | Disordered | ||||
Sequence: MPAERKKPASMEEKDSLPNNKEKDCSERRTVSSKERPKDDIKLTAKKEVSKAPEDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQAKRQQEEEAAAQMKEKEE | ||||||
Coiled coil | 54-134 | |||||
Sequence: EDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQAKRQQEEEAAAQMKEKEESIQLHQEA | ||||||
Region | 94-133 | Sufficient for interaction with UPF1 | ||||
Sequence: KKKHQEEERKKQEEQAKRQQEEEAAAQMKEKEESIQLHQE | ||||||
Domain | 168-431 | MIF4G 1 | ||||
Sequence: LKKNTAFVKKLKTITEQQRDSLSHDFNGLNLSKYIAEAVASIVEAKLKISDVNCAVHLCSLFHQRYADFAPSLLQVWKKHFEARKEEKTPNITKLRTDLRFIAELTIVGIFTDKEGLSLIYEQLKNIINADRESHTHVSVVISFCRHCGDDIAGLVPRKVKSAAEKFNLSFPPSEIISPEKQQPFQNLLKEYFTSLTKHLKRDHRELQNTERQNRRILHSKGELSEDRHKQYEEFAMSYQKLLANSQSLADLLDENMPDLPQDK | ||||||
Region | 370-389 | Disordered | ||||
Sequence: DHRELQNTERQNRRILHSKG | ||||||
Region | 423-445 | Disordered | ||||
Sequence: NMPDLPQDKPTPEEHGPGIDIFT | ||||||
Coiled coil | 487-559 | |||||
Sequence: EKSCQNKESNKDDTKEAKESKENKEVSSPDDLELELENLEINDDTLELEGGDEAEDLTKKLLDEQEQEDEEAS | ||||||
Region | 490-517 | Disordered | ||||
Sequence: CQNKESNKDDTKEAKESKENKEVSSPDD | ||||||
Domain | 569-758 | MIF4G 2 | ||||
Sequence: DAFLQQLPNCVNRDLIDKAAMDFCMNMNTKANRKKLVRALFIVPRQRLDLLPFYARLVATLHPCMSDVAEDLCSMLRGDFRFHVRKKDQINIETKNKTVRFIGELTKFKMFTKNDTLHCLKMLLSDFSHHHIEMACTLLETCGRFLFRSPESHLRTSVLLEQMMRKKQAMHLDARYVTMVENAYYYCNPP | ||||||
Region | 711-928 | Sufficient for interaction with UPF3A and UPF3B | ||||
Sequence: GRFLFRSPESHLRTSVLLEQMMRKKQAMHLDARYVTMVENAYYYCNPPPAEKTVKKKRPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDT | ||||||
Region | 757-1272 | Sufficient for interaction with EIF4A1 and EIF1 | ||||
Sequence: PPPAEKTVKKKRPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVNDKDSKDSMTEGENLEEDEEEEEGGAETEEQSGNESEVNEPEEEEGSDNDDDEGEEEEEENTDYLTDSNKENETDEENTEVMIKGGGLKHVPCVEDEDFIQALDKMMLENLQQRSGESVKVHQLDVAIPLHLKSQLRKGPPLGGGEGEAESADTMPFVMLTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGGRRR | ||||||
Domain | 773-986 | MIF4G 3 | ||||
Sequence: EYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPK | ||||||
Region | 839-859 | Binds to UPF3B | ||||
Sequence: EDVGIHVVDGVLEDIRLGMEV | ||||||
Region | 1018-1098 | Disordered | ||||
Sequence: DSKDSMTEGENLEEDEEEEEGGAETEEQSGNESEVNEPEEEEGSDNDDDEGEEEEEENTDYLTDSNKENETDEENTEVMIK | ||||||
Compositional bias | 1025-1078 | Acidic residues | ||||
Sequence: EGENLEEDEEEEEGGAETEEQSGNESEVNEPEEEEGSDNDDDEGEEEEEENTDY | ||||||
Compositional bias | 1079-1097 | Basic and acidic residues | ||||
Sequence: LTDSNKENETDEENTEVMI | ||||||
Region | 1084-1272 | Sufficient for interaction with UPF1 C-terminus | ||||
Sequence: KENETDEENTEVMIKGGGLKHVPCVEDEDFIQALDKMMLENLQQRSGESVKVHQLDVAIPLHLKSQLRKGPPLGGGEGEAESADTMPFVMLTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGGRRR | ||||||
Region | 1105-1129 | Interaction with UPF1 | ||||
Sequence: VPCVEDEDFIQALDKMMLENLQQRS | ||||||
Region | 1105-1198 | Necessary for interaction with UPF1 | ||||
Sequence: VPCVEDEDFIQALDKMMLENLQQRSGESVKVHQLDVAIPLHLKSQLRKGPPLGGGEGEAESADTMPFVMLTRKGNKQQFKILNVPMSSQLAANH | ||||||
Region | 1167-1207 | Interaction with UPF1 | ||||
Sequence: DTMPFVMLTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQE | ||||||
Region | 1220-1272 | Disordered | ||||
Sequence: NERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGGRRR |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,272
- Mass (Da)147,810
- Last updated2001-03-01 v1
- Checksum95F3C57D2854BB44
Sequence caution
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 119 | in Ref. 5; BAC04721 | ||||
Sequence: A → T | ||||||
Sequence conflict | 338 | in Ref. 5; BAC04721 | ||||
Sequence: F → L | ||||||
Sequence conflict | 844 | in Ref. 2; AAG48509 and 4; BAA92646 | ||||
Sequence: H → Q | ||||||
Sequence conflict | 969 | in Ref. 4; BAA92646 | ||||
Sequence: P → S | ||||||
Compositional bias | 1025-1078 | Acidic residues | ||||
Sequence: EGENLEEDEEEEEGGAETEEQSGNESEVNEPEEEEGSDNDDDEGEEEEEENTDY | ||||||
Compositional bias | 1079-1097 | Basic and acidic residues | ||||
Sequence: LTDSNKENETDEENTEVMI |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF301013 EMBL· GenBank· DDBJ | AAG33225.1 EMBL· GenBank· DDBJ | mRNA | ||
AY013249 EMBL· GenBank· DDBJ | AAG48509.1 EMBL· GenBank· DDBJ | mRNA | ||
AF318574 EMBL· GenBank· DDBJ | AAG60689.1 EMBL· GenBank· DDBJ | mRNA | ||
AB037829 EMBL· GenBank· DDBJ | BAA92646.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK000764 EMBL· GenBank· DDBJ | BAA91369.1 EMBL· GenBank· DDBJ | mRNA | ||
AK096191 EMBL· GenBank· DDBJ | BAC04721.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
AC073160 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL138898 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL645617 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471072 EMBL· GenBank· DDBJ | EAW86329.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471072 EMBL· GenBank· DDBJ | EAW86330.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471072 EMBL· GenBank· DDBJ | EAW86332.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471072 EMBL· GenBank· DDBJ | EAW86333.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC114964 EMBL· GenBank· DDBJ | AAI14965.1 EMBL· GenBank· DDBJ | mRNA | ||
BC115737 EMBL· GenBank· DDBJ | AAI15738.1 EMBL· GenBank· DDBJ | mRNA | ||
AL080198 EMBL· GenBank· DDBJ | CAB45771.1 EMBL· GenBank· DDBJ | mRNA |