Q9HAF1 · EAF6_HUMAN
- ProteinChromatin modification-related protein MEAF6
- GeneMEAF6
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids191 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A (PubMed:14966270).
This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription (PubMed:14966270).
Component of HBO1 complexes, which specifically mediate acetylation of histone H3 at 'Lys-14' (H3K14ac), and have reduced activity toward histone H4 (PubMed:16387653, PubMed:24065767).
Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity (PubMed:18794358).
This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription (PubMed:14966270).
Component of HBO1 complexes, which specifically mediate acetylation of histone H3 at 'Lys-14' (H3K14ac), and have reduced activity toward histone H4 (PubMed:16387653, PubMed:24065767).
Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity (PubMed:18794358).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | histone acetyltransferase complex | |
Cellular Component | kinetochore | |
Cellular Component | MOZ/MORF histone acetyltransferase complex | |
Cellular Component | NuA4 histone acetyltransferase complex | |
Cellular Component | nucleolus | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleosome | |
Cellular Component | nucleus | |
Biological Process | chromatin remodeling | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | positive regulation of double-strand break repair via homologous recombination | |
Biological Process | regulation of apoptotic process | |
Biological Process | regulation of cell cycle | |
Biological Process | regulation of cell growth | |
Biological Process | regulation of developmental process | |
Biological Process | regulation of DNA biosynthetic process | |
Biological Process | regulation of DNA replication | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | regulation of double-strand break repair | |
Biological Process | regulation of hemopoiesis |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameChromatin modification-related protein MEAF6
- Short namesMYST/Esa1-associated factor 6
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9HAF1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 177 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain, cross-link, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Initiator methionine | 1 | UniProt | Removed | ||||
Sequence: M | |||||||
Modified residue | 2 | UniProt | N-acetylalanine | ||||
Sequence: A | |||||||
Chain | PRO_0000272609 | 2-191 | UniProt | Chromatin modification-related protein MEAF6 | |||
Sequence: AMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRIDLKLNKKPRADY | |||||||
Modified residue | 6 | UniProt | N6-acetyllysine | ||||
Sequence: K | |||||||
Modified residue | 69 | UniProt | N6-acetyllysine; alternate | ||||
Sequence: K | |||||||
Cross-link | 69 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate | ||||
Sequence: K | |||||||
Modified residue | 74 | UniProt | N6-acetyllysine | ||||
Sequence: K | |||||||
Cross-link | 113 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternate | ||||
Sequence: K | |||||||
Cross-link | 113 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate | ||||
Sequence: K | |||||||
Modified residue | 118 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 118 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 120 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 120 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 122 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Component of the NuA4 histone acetyltransferase complex which contains the catalytic subunit KAT5 and the subunits EP400, TRRAP, BRD8, EPC1, DMAP1, RUVBL1, RUVBL2, ING3, actin, ACTL6A, MORF4L1, MORF4L2, MRGBP, YEATS4, VPS72 and MEAF6 (PubMed:12963728, PubMed:14966270, PubMed:15647280).
Component of the HBO1 complex composed of KAT7/HBO1, MEAF6, ING4 or ING5, and one scaffold subunit: complexes containing BRPF scaffold (BRPF1, BRD1/BRPF2 or BRPF3) direct KAT7/HBO1 specificity towards H3K14ac, while complexes containing JADE scaffold (JADE1, JADE2 and JADE3) mediate acetylation of histone H4 (PubMed:16387653, PubMed:24065767).
Component of the MOZ/MORF complex composed at least of ING5, KAT6A, KAT6B, MEAF6 and one of BRPF1, BRD1/BRPF2 and BRPF3 (PubMed:18794358).
Component of the HBO1 complex composed of KAT7/HBO1, MEAF6, ING4 or ING5, and one scaffold subunit: complexes containing BRPF scaffold (BRPF1, BRD1/BRPF2 or BRPF3) direct KAT7/HBO1 specificity towards H3K14ac, while complexes containing JADE scaffold (JADE1, JADE2 and JADE3) mediate acetylation of histone H4 (PubMed:16387653, PubMed:24065767).
Component of the MOZ/MORF complex composed at least of ING5, KAT6A, KAT6B, MEAF6 and one of BRPF1, BRD1/BRPF2 and BRPF3 (PubMed:18794358).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9HAF1 | BYSL Q13895 | 3 | EBI-399266, EBI-358049 | |
BINARY | Q9HAF1 | C2CD6 Q53TS8 | 3 | EBI-399266, EBI-739879 | |
BINARY | Q9HAF1 | ELAVL4 P26378-2 | 3 | EBI-399266, EBI-21603100 | |
BINARY | Q9HAF1 | FGFR3 P22607 | 3 | EBI-399266, EBI-348399 | |
BINARY | Q9HAF1 | FXR2 P51116 | 3 | EBI-399266, EBI-740459 | |
BINARY | Q9HAF1 | HTT P42858 | 6 | EBI-399266, EBI-466029 | |
BINARY | Q9HAF1 | JADE2 A0A0C4DFT8 | 3 | EBI-399266, EBI-12094820 | |
BINARY | Q9HAF1 | L3MBTL2 Q969R5 | 5 | EBI-399266, EBI-739909 | |
BINARY | Q9HAF1 | LDOC1 O95751 | 3 | EBI-399266, EBI-740738 | |
BINARY | Q9HAF1 | PLEKHF2 Q9H8W4 | 5 | EBI-399266, EBI-742388 | |
BINARY | Q9HAF1 | RFC5 P40937 | 3 | EBI-399266, EBI-712376 | |
BINARY | Q9HAF1 | TRIM54 Q9BYV2 | 3 | EBI-399266, EBI-2130429 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for coiled coil, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 11-47 | |||||
Sequence: QIPDTRRELAELVKRKQELAETLANLERQIYAFEGSY | ||||||
Region | 104-191 | Disordered | ||||
Sequence: AGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRIDLKLNKKPRADY | ||||||
Compositional bias | 164-182 | Basic residues | ||||
Sequence: HHSSHKKRKNKNRHRIDLK |
Sequence similarities
Belongs to the EAF6 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing.
Q9HAF1-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length191
- Mass (Da)21,635
- Last updated2001-03-01 v1
- ChecksumC0FBC7566BAAF1F7
Q9HAF1-2
- Name2
- Differences from canonical
- 178-191: RIDLKLNKKPRADY → SPSGMFDYDFEYVY
Q9HAF1-3
- Name3
- Differences from canonical
- 178-178: R → SPSGMFDYDFE
Q9HAF1-4
- Name4
- Differences from canonical
- 179-191: IDLKLNKKPRADY → MNVSPKTGWHQLHL
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
B1AK63 | B1AK63_HUMAN | MEAF6 | 169 |
Features
Showing features for sequence conflict, compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 2-3 | in Ref. 6; AAO65179 | ||||
Sequence: AM → RG | ||||||
Sequence conflict | 4 | in Ref. 3; AAZ13760 | ||||
Sequence: H → P | ||||||
Compositional bias | 164-182 | Basic residues | ||||
Sequence: HHSSHKKRKNKNRHRIDLK | ||||||
Alternative sequence | VSP_022451 | 178 | in isoform 3 | |||
Sequence: R → SPSGMFDYDFE | ||||||
Alternative sequence | VSP_022450 | 178-191 | in isoform 2 | |||
Sequence: RIDLKLNKKPRADY → SPSGMFDYDFEYVY | ||||||
Alternative sequence | VSP_047018 | 179-191 | in isoform 4 | |||
Sequence: IDLKLNKKPRADY → MNVSPKTGWHQLHL |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX538212 EMBL· GenBank· DDBJ | CAD98071.1 EMBL· GenBank· DDBJ | mRNA | ||
BX640719 EMBL· GenBank· DDBJ | CAE45838.1 EMBL· GenBank· DDBJ | mRNA | ||
AK021792 EMBL· GenBank· DDBJ | BAB13898.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ099384 EMBL· GenBank· DDBJ | AAZ13760.1 EMBL· GenBank· DDBJ | mRNA | ||
AL034379 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC056406 EMBL· GenBank· DDBJ | AAH56406.1 EMBL· GenBank· DDBJ | mRNA | ||
BC016328 EMBL· GenBank· DDBJ | AAH16328.1 EMBL· GenBank· DDBJ | mRNA | ||
AY211926 EMBL· GenBank· DDBJ | AAO65179.1 EMBL· GenBank· DDBJ | mRNA |