Q9H9Q2 · CSN7B_HUMAN
- ProteinCOP9 signalosome complex subunit 7b
- GeneCOPS7B
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids264 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, JUN, I-kappa-B-alpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | COP9 signalosome | |
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Biological Process | COP9 signalosome assembly | |
Biological Process | protein deneddylation | |
Biological Process | regulation of protein neddylation |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCOP9 signalosome complex subunit 7b
- Short namesSGN7b; Signalosome subunit 7b
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9H9Q2
- Secondary accessions
Proteomes
Organism-specific databases
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 252 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Initiator methionine | 1 | UniProt | Removed | ||||
Sequence: M | |||||||
Modified residue | 2 | UniProt | N-acetylalanine | ||||
Sequence: A | |||||||
Chain | PRO_0000120999 | 2-264 | UniProt | COP9 signalosome complex subunit 7b | |||
Sequence: AGEQKPSSNLLEQFILLAKGTSGSALTALISQVLEAPGVYVFGELLELANVQELAEGANAAYLQLLNLFAYGTYPDYIANKESLPELSTAQQNKLKHLTIVSLASRMKCIPYSVLLKDLEMRNLRELEDLIIEAVYTDIIQGKLDQRNQLLEVDFCIGRDIRKKDINNIVKTLHEWCDGCEAVLLGIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLAERECPPHAEQRQPTKKMSKVKGLVSSRH | |||||||
Modified residue (large scale data) | 225 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 261 | UniProt | In isoform Q9H9Q2-3; Phosphothreonine | ||||
Sequence: S | |||||||
Modified residue | 263 | UniProt | In isoform Q9H9Q2-3; Phosphoserine | ||||
Sequence: R |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Component of the CSN complex, composed of COPS1/GPS1, COPS2, COPS3, COPS4, COPS5, COPS6, COPS7 (COPS7A or COPS7B), COPS8 and COPS9 isoform 1 (PubMed:11337588, PubMed:18850735, PubMed:26456823).
In the complex, it probably interacts directly with COPS1, COPS2, COPS4, COPS5, COPS6 and COPS8 (PubMed:11337588, PubMed:18850735).
Interacts with EIF3S6 (PubMed:12220626).
In the complex, it probably interacts directly with COPS1, COPS2, COPS4, COPS5, COPS6 and COPS8 (PubMed:11337588, PubMed:18850735).
Interacts with EIF3S6 (PubMed:12220626).
(Microbial infection) Interacts with vaccinia virus protein C9L.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9H9Q2 | BEX5 Q5H9J7 | 3 | EBI-2510162, EBI-10243741 | |
BINARY | Q9H9Q2 | CCT5 P48643 | 3 | EBI-2510162, EBI-355710 | |
BINARY | Q9H9Q2 | HSPB1 P04792 | 3 | EBI-2510162, EBI-352682 | |
BINARY | Q9H9Q2 | NMI Q13287 | 9 | EBI-2510162, EBI-372942 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, coiled coil, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 2-159 | PCI | ||||
Sequence: AGEQKPSSNLLEQFILLAKGTSGSALTALISQVLEAPGVYVFGELLELANVQELAEGANAAYLQLLNLFAYGTYPDYIANKESLPELSTAQQNKLKHLTIVSLASRMKCIPYSVLLKDLEMRNLRELEDLIIEAVYTDIIQGKLDQRNQLLEVDFCIG | ||||||
Coiled coil | 188-237 | |||||
Sequence: IEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLAE | ||||||
Region | 223-264 | Disordered | ||||
Sequence: TASSSAQEMEQQLAERECPPHAEQRQPTKKMSKVKGLVSSRH | ||||||
Compositional bias | 236-252 | Basic and acidic residues | ||||
Sequence: AERECPPHAEQRQPTKK |
Sequence similarities
Belongs to the CSN7/EIF3M family. CSN7 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q9H9Q2-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length264
- Mass (Da)29,622
- Last updated2001-03-01 v1
- ChecksumFF9279CEA6CB7707
Q9H9Q2-2
- Name2
- Differences from canonical
- 1-107: Missing
Q9H9Q2-3
- Name3
- Differences from canonical
- 213-264: VTNIKKTLKATASSSAQEMEQQLAERECPPHAEQRQPTKKMSKVKGLVSSRH → REKRDVPLLNLITTAFFWLPTSRRHSKPPHPPRLRRWSSSWLNGSVPLTLSRGSPPRRCPK
Computationally mapped potential isoform sequences
There are 11 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
J3KQ41 | J3KQ41_HUMAN | COPS7B | 278 | ||
J3KQ34 | J3KQ34_HUMAN | COPS7B | 230 | ||
J3KQV6 | J3KQV6_HUMAN | COPS7B | 54 | ||
A0A087X1P5 | A0A087X1P5_HUMAN | COPS7B | 209 | ||
J3QT95 | J3QT95_HUMAN | COPS7B | 150 | ||
J3QT43 | J3QT43_HUMAN | COPS7B | 103 | ||
J3QT50 | J3QT50_HUMAN | COPS7B | 78 | ||
J3QT65 | J3QT65_HUMAN | COPS7B | 49 | ||
J3QT66 | J3QT66_HUMAN | COPS7B | 62 | ||
J3QT67 | J3QT67_HUMAN | COPS7B | 62 | ||
J3QT73 | J3QT73_HUMAN | COPS7B | 172 |
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_011913 | 1-107 | in isoform 2 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_040266 | 213-264 | in isoform 3 | |||
Sequence: VTNIKKTLKATASSSAQEMEQQLAERECPPHAEQRQPTKKMSKVKGLVSSRH → REKRDVPLLNLITTAFFWLPTSRRHSKPPHPPRLRRWSSSWLNGSVPLTLSRGSPPRRCPK | ||||||
Compositional bias | 236-252 | Basic and acidic residues | ||||
Sequence: AERECPPHAEQRQPTKK |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK022674 EMBL· GenBank· DDBJ | BAB14170.1 EMBL· GenBank· DDBJ | mRNA | ||
AK024273 EMBL· GenBank· DDBJ | BAB14868.1 EMBL· GenBank· DDBJ | mRNA | ||
AC073476 EMBL· GenBank· DDBJ | AAY24152.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471063 EMBL· GenBank· DDBJ | EAW70980.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC010739 EMBL· GenBank· DDBJ | AAH10739.2 EMBL· GenBank· DDBJ | mRNA | ||
BC091493 EMBL· GenBank· DDBJ | AAH91493.1 EMBL· GenBank· DDBJ | mRNA |