Q9H9E1 · ANRA2_HUMAN
- ProteinAnkyrin repeat family A protein 2
- GeneANKRA2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids313 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May regulate the interaction between the 3M complex and the histone deacetylases HDAC4 and HDAC5 (PubMed:25752541).
May also regulate LRP2/megalin (By similarity).
May also regulate LRP2/megalin (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoskeleton | |
Cellular Component | cytosol | |
Cellular Component | membrane | |
Cellular Component | nucleus | |
Cellular Component | protein-containing complex | |
Molecular Function | histone deacetylase binding | |
Molecular Function | low-density lipoprotein particle receptor binding | |
Molecular Function | protein kinase binding | |
Molecular Function | ubiquitin protein ligase binding | |
Biological Process | regulation of gene expression | |
Biological Process | regulation of protein-containing complex assembly |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAnkyrin repeat family A protein 2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9H9E1
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 31 | No effect on interaction with CCDC8. | ||||
Sequence: K → R | ||||||
Mutagenesis | 188 | Loss of interaction with CCDC8. Decreased affinity for HDAC4. | ||||
Sequence: W → A | ||||||
Mutagenesis | 254 | Decreased affinity for HDAC4. | ||||
Sequence: Y → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 312 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000066895 | 1-313 | UniProt | Ankyrin repeat family A protein 2 | |||
Sequence: MDTSTNLDIGAQLIVEECPSTYSLTGMPDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRFDMNVCSRFVKSLNEEDSKNIQDQVNSDLEVASVLFKAECNIHTSPSPGIQVRHVYTPSTTKHFSPIKQSTTLTNKHRGNEVSTTPLLANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQNIKE | |||||||
Modified residue (large scale data) | 104 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 106 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 124 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts (via ANK repeats) with CCDC8 (via PxLPxI/L motif); mediates the interaction with the 3M complex which is composed of CCDC8, CUL7 and OBSL1 (PubMed:25752541).
Interacts (via ANK repeats) with HDAC4 (via PxLPxI/L motif) (PubMed:22649097).
Interacts (via ANK repeats) with HDAC5 (via PxLPxI/L motif) (PubMed:22649097).
Interacts (via ANK repeats) with LRP2/megalin (via PxLPxI/L motif) (PubMed:22649097).
Interacts (via ANK repeats) with RFX7 (via PxLPxI/L motif) (PubMed:25752541).
Interacts with AHRR (By similarity).
Interacts with NEK6 (PubMed:20873783).
Interacts (via ANK repeats) with HDAC4 (via PxLPxI/L motif) (PubMed:22649097).
Interacts (via ANK repeats) with HDAC5 (via PxLPxI/L motif) (PubMed:22649097).
Interacts (via ANK repeats) with LRP2/megalin (via PxLPxI/L motif) (PubMed:22649097).
Interacts (via ANK repeats) with RFX7 (via PxLPxI/L motif) (PubMed:25752541).
Interacts with AHRR (By similarity).
Interacts with NEK6 (PubMed:20873783).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9H9E1 | CCDC8 Q9H0W5 | 4 | EBI-10215533, EBI-5236005 | |
BINARY | Q9H9E1 | HDAC4 P56524 | 3 | EBI-10215533, EBI-308629 | |
BINARY | Q9H9E1 | HDAC5 Q9UQL6 | 2 | EBI-10215533, EBI-715576 | |
BINARY | Q9H9E1 | RFX7 Q2KHR2 | 2 | EBI-10215533, EBI-1222187 | |
BINARY | Q9H9E1 | SAMD4A Q9UPU9-3 | 3 | EBI-10215533, EBI-11986417 | |
BINARY | Q9H9E1 | TSHZ3 Q63HK5 | 3 | EBI-10215533, EBI-9053916 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 148-180 | ANK 1 | ||||
Sequence: ANSLSVHQLAAQGEMLYLATRIEQENVINHTDE | ||||||
Repeat | 181-213 | ANK 2 | ||||
Sequence: EGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGK | ||||||
Repeat | 214-246 | ANK 3 | ||||
Sequence: GRESALSLACSKGYTDIVKMLLDCGVDVNEYDW | ||||||
Repeat | 247-279 | ANK 4 | ||||
Sequence: NGGTPLLYAVHGNHVKCVKMLLESGADPTIETD | ||||||
Repeat | 280-313 | ANK 5 | ||||
Sequence: SGYNSMDLAVALGYRSVQQVIESHLLKLLQNIKE |
Domain
The ankyrin repeats, mainly ANK 2, ANK 3 and ANK 4, mediate interaction with a wide array of PxLPxI/L motif-containing proteins including HDAC4 and LRP2. The PxLPxI/L motif of interactors can contain a Ser or a Thr residue in position 2, which phosphorylation prevents the interaction with ANKRA2.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length313
- Mass (Da)34,272
- Last updated2001-03-01 v1
- Checksum31C653B10B4ED6E1
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
D6RBK8 | D6RBK8_HUMAN | ANKRA2 | 177 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF314032 EMBL· GenBank· DDBJ | AAK01621.1 EMBL· GenBank· DDBJ | mRNA | ||
AK022876 EMBL· GenBank· DDBJ | BAB14288.1 EMBL· GenBank· DDBJ | mRNA | ||
AF251051 EMBL· GenBank· DDBJ | AAK34941.1 EMBL· GenBank· DDBJ | mRNA | ||
BC012917 EMBL· GenBank· DDBJ | AAH12917.1 EMBL· GenBank· DDBJ | mRNA |