Q9H7V2 · SYNG1_HUMAN
- ProteinSynapse differentiation-inducing gene protein 1
- GeneSYNDIG1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids258 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May regulate AMPA receptor content at nascent synapses, and have a role in postsynaptic development and maturation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell body | |
Cellular Component | dendritic shaft | |
Cellular Component | dendritic spine | |
Cellular Component | early endosome membrane | |
Cellular Component | excitatory synapse | |
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | plasma membrane | |
Cellular Component | postsynaptic density | |
Cellular Component | postsynaptic density membrane | |
Cellular Component | synaptic vesicle membrane | |
Molecular Function | glutamate receptor binding | |
Molecular Function | protein homodimerization activity | |
Biological Process | intracellular protein transport | |
Biological Process | positive regulation of synapse assembly | |
Biological Process | synaptic vesicle clustering |
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameSynapse differentiation-inducing gene protein 1
- Short namesSynDIG1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9H7V2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type II membrane protein
Early endosome membrane ; Single-pass type II membrane protein
Note: Shuttles between the cell surface and early endosome membrane.
Features
Showing features for topological domain, transmembrane, intramembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-181 | Cytoplasmic | ||||
Sequence: MDGIIEQKSMLVHSKISDAGKRNGLINTRNLMAESRDGLVSVYPAPQYQSHRVGASTVPASLDSSRSEPMQQLLDPNTLQQSVESRYRPNIILYSEGVLRSWGDGVAADCCETTFIEDRSPTKDSLEYPDGKFIDLSADDIKIHTLSYDVEEEEEFQELESDYSSDTESEDNFLMMPPRDH | ||||||
Transmembrane | 182-202 | Helical | ||||
Sequence: LGLSVFSMLCCFWPLGIAAFY | ||||||
Topological domain | 203-228 | Extracellular | ||||
Sequence: LSHETNKAVAKGDLHQASTSSRRALF | ||||||
Intramembrane | 229-249 | Helical | ||||
Sequence: LAVLSITIGTGVYVGVAVALI | ||||||
Topological domain | 250-258 | Extracellular | ||||
Sequence: AYLSKNNHL |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_053733 | 54 | in dbSNP:rs6083553 | |||
Sequence: G → R |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 335 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000135696 | 1-258 | Synapse differentiation-inducing gene protein 1 | |||
Sequence: MDGIIEQKSMLVHSKISDAGKRNGLINTRNLMAESRDGLVSVYPAPQYQSHRVGASTVPASLDSSRSEPMQQLLDPNTLQQSVESRYRPNIILYSEGVLRSWGDGVAADCCETTFIEDRSPTKDSLEYPDGKFIDLSADDIKIHTLSYDVEEEEEFQELESDYSSDTESEDNFLMMPPRDHLGLSVFSMLCCFWPLGIAAFYLSHETNKAVAKGDLHQASTSSRRALFLAVLSITIGTGVYVGVAVALIAYLSKNNHL | ||||||
Modified residue | 137 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Homodimer. Interacts with GRIA1 and GRIA2 (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9H7V2 | AQP6 Q13520 | 3 | EBI-726331, EBI-13059134 | |
BINARY | Q9H7V2 | ELOVL4 Q9GZR5 | 3 | EBI-726331, EBI-18535450 | |
BINARY | Q9H7V2 | FATE1 Q969F0 | 6 | EBI-726331, EBI-743099 | |
BINARY | Q9H7V2 | FFAR2 O15552 | 3 | EBI-726331, EBI-2833872 | |
BINARY | Q9H7V2 | GPR42 O15529 | 3 | EBI-726331, EBI-18076404 | |
BINARY | Q9H7V2 | GPRC5D Q9NZD1 | 3 | EBI-726331, EBI-13067820 | |
BINARY | Q9H7V2 | LEPROTL1 O95214 | 3 | EBI-726331, EBI-750776 | |
BINARY | Q9H7V2 | MAL P21145 | 3 | EBI-726331, EBI-3932027 | |
BINARY | Q9H7V2 | MFSD6 Q6ZSS7 | 3 | EBI-726331, EBI-2858252 | |
BINARY | Q9H7V2 | SLC16A13 Q7RTY0 | 3 | EBI-726331, EBI-12243266 | |
BINARY | Q9H7V2 | SLC35C2 Q9NQQ7-3 | 3 | EBI-726331, EBI-17295964 | |
BINARY | Q9H7V2 | SLC41A1 Q8IVJ1 | 3 | EBI-726331, EBI-12266234 | |
BINARY | Q9H7V2 | TLCD4 Q96MV1 | 3 | EBI-726331, EBI-12947623 | |
BINARY | Q9H7V2 | TMEM43 Q9BTV4 | 3 | EBI-726331, EBI-721293 | |
BINARY | Q9H7V2 | UNC93B1 Q9H1C4 | 3 | EBI-726331, EBI-4401271 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length258
- Mass (Da)28,551
- Last updated2001-03-01 v1
- Checksum89EDF1AE382246A2
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK024282 EMBL· GenBank· DDBJ | BAB14872.1 EMBL· GenBank· DDBJ | mRNA | ||
CR457325 EMBL· GenBank· DDBJ | CAG33606.1 EMBL· GenBank· DDBJ | mRNA | ||
AL049594 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL157413 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC030637 EMBL· GenBank· DDBJ | AAH30637.1 EMBL· GenBank· DDBJ | mRNA |