Q9H790 · EXO5_HUMAN
- ProteinExonuclease V
- GeneEXO5
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids373 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Single-stranded DNA (ssDNA) bidirectional exonuclease involved in DNA repair. Probably involved in DNA repair following ultraviolet (UV) irradiation and interstrand cross-links (ICLs) damage. Has both 5'-3' and 3'-5' exonuclease activities with a strong preference for 5'-ends. Acts as a sliding exonuclease that loads at ssDNA ends and then slides along the ssDNA prior to cutting; however the sliding and the 3'-5' exonuclease activities are abolished upon binding to the replication protein A (RPA) complex that enforces 5'-directionality activity.
Cofactor
Protein has several cofactor binding sites:
Note: Binds 1 [4Fe-4S] cluster.
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | 4 iron, 4 sulfur cluster binding | |
Molecular Function | DNA binding | |
Molecular Function | metal ion binding | |
Molecular Function | single-stranded DNA 3'-5' DNA exonuclease activity | |
Molecular Function | single-stranded DNA 5'-3' DNA exonuclease activity | |
Biological Process | interstrand cross-link repair |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameExonuclease V
- EC number
- Short namesExo V; hExo5
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9H790
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes to repair foci in response to DNA damage.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_035407 | 115 | does not affect exonuclease activity; dbSNP:rs1134586 | |||
Sequence: D → N | ||||||
Natural variant | VAR_035408 | 172 | does not affect exonuclease activity; dbSNP:rs11208299 | |||
Sequence: G → V | ||||||
Mutagenesis | 196 | Nearly abolishes exonuclease activity. | ||||
Sequence: E → A | ||||||
Mutagenesis | 343 | Abolishes iron-sulfur-binding and affects exonuclease activity; when associated with A-346. | ||||
Sequence: C → A | ||||||
Mutagenesis | 346 | Abolishes iron-sulfur-binding and affects exonuclease activity; when associated with A-343. | ||||
Sequence: C → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 422 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000307320 | 1-373 | Exonuclease V | |||
Sequence: MAETREEETVSAEASGFSDLSDSEFLEFLDLEDAQESKALVNMPGPSSESLGKDDKPISLQNWKRGLDILSPMERFHLKYLYVTDLATQNWCELQTAYGKELPGFLAPEKAAVLDTGASIHLARELELHDLVTVPVTTKEDAWAIKFLNILLLIPTLQSEGHIREFPVFGEGEGVLLVGVIDELHYTAKGELELAELKTRRRPMLPLEAQKKKDCFQVSLYKYIFDAMVQGKVTPASLIHHTKLCLEKPLGPSVLRHAQQGGFSVKSLGDLMELVFLSLTLSDLPVIDILKIEYIHQETATVLGTEIVAFKEKEVRAKVQHYMAYWMGHREPQGVDVEEAWKCRTCTYADICEWRKGSGVLSSTLAPQVKKAK |
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Monomer; monomeric form has weak exonuclease activity. Homodimer; homodimeric form is unsure but has much higher exonuclease activity, suggesting that it could homodimerize upon DNA-binding. Interacts with the replication protein A (RPA) complex.
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length373
- Mass (Da)41,816
- Last updated2001-03-01 v1
- ChecksumEAFB31099EA40FAD
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK024797 EMBL· GenBank· DDBJ | BAB15008.1 EMBL· GenBank· DDBJ | mRNA | ||
AL603839 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471059 EMBL· GenBank· DDBJ | EAX07210.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471059 EMBL· GenBank· DDBJ | EAX07211.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471059 EMBL· GenBank· DDBJ | EAX07212.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471059 EMBL· GenBank· DDBJ | EAX07213.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471059 EMBL· GenBank· DDBJ | EAX07214.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC021969 EMBL· GenBank· DDBJ | AAH21969.1 EMBL· GenBank· DDBJ | mRNA |