Q9H4W6 · COE3_HUMAN
- ProteinTranscription factor COE3
- GeneEBF3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids596 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcriptional activator (PubMed:28017370, PubMed:28017372, PubMed:28017373).
Recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3' (By similarity).
Recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3' (By similarity).
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 163 | Interaction with DNA | ||||
Sequence: R | ||||||
Site | 172 | Interaction with DNA | ||||
Sequence: N |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | metal ion binding | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTranscription factor COE3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9H4W6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Hypotonia, ataxia, and delayed development syndrome (HADDS)
- Note
- DescriptionAn autosomal dominant neurodevelopmental syndrome characterized by global developmental delay, moderate to severe intellectual disability, cerebellar ataxia, hypotonia, speech delay, variable dysmorphic features, and genitourinary abnormalities including vesicoureteric reflux.
- See alsoMIM:617330
Natural variants in HADDS
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_078033 | 66 | N>D | in HADDS; significant loss of transcriptional activator activity; localizes both in the cytoplasm and the nucleus; decreased chromatin binding; dbSNP:rs1057519518 | |
VAR_078034 | 141 | Y>C | in HADDS; significant loss of transcriptional activator activity; localizes both in the cytoplasm and the nucleus; decreased chromatin-binding; dbSNP:rs1057519519 | |
VAR_078035 | 159 | I>IHEI | in HADDS; significant loss of transcriptional activator activity; localizes both in the cytoplasm and the nucleus; decreased chromatin-binding | |
VAR_078036 | 163 | R>L | in HADDS; partial loss of transcriptional activator activity; dbSNP:rs1057519389 | |
VAR_078037 | 163 | R>P | in HADDS; loss of transcriptional activator activity; dbSNP:rs1057519389 | |
VAR_078038 | 163 | R>Q | in HADDS; loss of transcriptional activator activity; dbSNP:rs1057519389 | |
VAR_078039 | 171 | G>D | in HADDS; significant loss of transcriptional activator activity; localizes both in the cytoplasm and the nucleus; decreased chromatin-binding; dbSNP:rs1057519437 | |
VAR_078040 | 177 | P>L | in HADDS; according to PubMed:28017373 shows significant loss of transcriptional activator activity while according to PubMed:28017370 shows partial loss of transcriptional activator activity; localizes both in the cytoplasm and the nucleus; decreased chromatin-binding; dbSNP:rs869312668 | |
VAR_078041 | 193 | K>N | in HADDS; significant loss of transcriptional activator activity; dbSNP:rs1057519520 | |
VAR_078042 | 209 | R>W | in HADDS; significant loss of transcriptional activator activity; localizes both in the cytoplasm and the nucleus; decreased chromatin-binding; dbSNP:rs779003155 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_078033 | 66 | in HADDS; significant loss of transcriptional activator activity; localizes both in the cytoplasm and the nucleus; decreased chromatin binding; dbSNP:rs1057519518 | |||
Sequence: N → D | ||||||
Natural variant | VAR_078034 | 141 | in HADDS; significant loss of transcriptional activator activity; localizes both in the cytoplasm and the nucleus; decreased chromatin-binding; dbSNP:rs1057519519 | |||
Sequence: Y → C | ||||||
Natural variant | VAR_078035 | 159 | in HADDS; significant loss of transcriptional activator activity; localizes both in the cytoplasm and the nucleus; decreased chromatin-binding | |||
Sequence: I → IHEI | ||||||
Natural variant | VAR_078036 | 163 | in HADDS; partial loss of transcriptional activator activity; dbSNP:rs1057519389 | |||
Sequence: R → L | ||||||
Natural variant | VAR_078037 | 163 | in HADDS; loss of transcriptional activator activity; dbSNP:rs1057519389 | |||
Sequence: R → P | ||||||
Natural variant | VAR_078038 | 163 | in HADDS; loss of transcriptional activator activity; dbSNP:rs1057519389 | |||
Sequence: R → Q | ||||||
Natural variant | VAR_078039 | 171 | in HADDS; significant loss of transcriptional activator activity; localizes both in the cytoplasm and the nucleus; decreased chromatin-binding; dbSNP:rs1057519437 | |||
Sequence: G → D | ||||||
Natural variant | VAR_078040 | 177 | in HADDS; according to PubMed:28017373 shows significant loss of transcriptional activator activity while according to PubMed:28017370 shows partial loss of transcriptional activator activity; localizes both in the cytoplasm and the nucleus; decreased chromatin-binding; dbSNP:rs869312668 | |||
Sequence: P → L | ||||||
Natural variant | VAR_078041 | 193 | in HADDS; significant loss of transcriptional activator activity; dbSNP:rs1057519520 | |||
Sequence: K → N | ||||||
Natural variant | VAR_078042 | 209 | in HADDS; significant loss of transcriptional activator activity; localizes both in the cytoplasm and the nucleus; decreased chromatin-binding; dbSNP:rs779003155 | |||
Sequence: R → W |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 751 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000107832 | 1-596 | Transcription factor COE3 | |||
Sequence: MFGIQENIPRGGTTMKEEPLGSGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKEPNNEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTAPSYLENATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTSMNGYGSGAMASLGVPGSPGFLNGSSANSPYGIVPSSPTMAASSVTLPSNCSSTHGIFSFSPANVISAVKQKSAFAPVVRPQASPPPSCTSANGNGLQAMSGLVVPPM |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in brain.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Forms either a homodimer or a heterodimer with a related family member.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9H4W6-2 | ATPAF2 Q8N5M1 | 3 | EBI-17233744, EBI-1166928 | |
BINARY | Q9H4W6-2 | EBF2 Q9HAK2 | 3 | EBI-17233744, EBI-12267154 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, zinc finger, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-22 | Disordered | ||||
Sequence: MFGIQENIPRGGTTMKEEPLGS | ||||||
Region | 63-66 | Interaction with DNA | ||||
Sequence: RKSN | ||||||
Zinc finger | 151-170 | C5-type | ||||
Sequence: CRVLLTHEIMCSRCCDKKSC | ||||||
Region | 197-204 | Interaction with DNA | ||||
Sequence: NCLKNAGN | ||||||
Region | 236-239 | Interaction with DNA | ||||
Sequence: NNSK | ||||||
Domain | 263-346 | IPT/TIG | ||||
Sequence: PCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYT | ||||||
Region | 451-483 | Disordered | ||||
Sequence: TSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNY |
Sequence similarities
Belongs to the COE family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9H4W6-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameLong
- Length596
- Mass (Da)64,864
- Last updated2001-05-04 v2
- ChecksumEE5C9D10CD3DED02
Q9H4W6-2
- NameShort
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
H0Y3W9 | H0Y3W9_HUMAN | EBF3 | 629 |
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL354950 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471066 EMBL· GenBank· DDBJ | EAW49160.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC126130 EMBL· GenBank· DDBJ | AAI26131.1 EMBL· GenBank· DDBJ | mRNA | ||
BC130479 EMBL· GenBank· DDBJ | AAI30480.1 EMBL· GenBank· DDBJ | mRNA |