Q9H2R5 · KLK15_HUMAN
- ProteinKallikrein-15
- GeneKLK15
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids256 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Protease whose physiological substrate is not yet known.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 62 | Charge relay system | ||||
Sequence: H | ||||||
Active site | 106 | Charge relay system | ||||
Sequence: D | ||||||
Active site | 209 | Charge relay system | ||||
Sequence: S |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | secretory granule | |
Molecular Function | serine-type endopeptidase activity | |
Molecular Function | serine-type peptidase activity | |
Biological Process | proteolysis |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameKallikrein-15
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9H2R5
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_020179 | 134 | in dbSNP:rs3212805 | |||
Sequence: P → L | ||||||
Natural variant | VAR_036298 | 137 | in a breast cancer sample; somatic mutation | |||
Sequence: A → T |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 392 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, propeptide, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-16 | |||||
Sequence: MWLLLTLSFLLASTAA | ||||||
Propeptide | PRO_0000027960 | 17-21 | Activation peptide | |||
Sequence: QDGDK | ||||||
Chain | PRO_0000027961 | 22-256 | Kallikrein-15 | |||
Sequence: LLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSRFMRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYPGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHYLEWIRETMKRN | ||||||
Disulfide bond | 47↔63 | |||||
Sequence: CGASLISPHWVLSAAHC | ||||||
Disulfide bond | 138↔215 | |||||
Sequence: CVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYPGRLTNTMVCAGAEGRGAESCEGDSGGPLVC | ||||||
Glycosylation | 171 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 180↔194 | |||||
Sequence: CDKSYPGRLTNTMVC | ||||||
Disulfide bond | 205↔230 | |||||
Sequence: CEGDSGGPLVCGGILQGIVSWGDVPC | ||||||
Glycosylation | 232 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Highest expression in the thyroid gland. Also expressed in the prostate, salivary, and adrenal glands and in the colon testis and kidney.
Gene expression databases
Organism-specific databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9H2R5 | DYNLT1 P63172 | 3 | EBI-8645371, EBI-1176455 | |
BINARY | Q9H2R5 | TRIP6 Q15654 | 3 | EBI-8645371, EBI-742327 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 22-254 | Peptidase S1 | ||||
Sequence: LLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSRFMRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYPGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHYLEWIRETMK |
Sequence similarities
Belongs to the peptidase S1 family. Kallikrein subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 5 isoforms produced by Alternative splicing.
Q9H2R5-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length256
- Mass (Da)28,087
- Last updated2001-03-01 v1
- ChecksumB5EBF8D6022786B5
Q9H2R5-2
- Name2
- NoteMay be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
- Differences from canonical
- 122-256: Missing
Q9H2R5-3
- Name3
Q9H2R5-4
- Name4
- Differences from canonical
- 122-206: Missing
Q9H2R5-5
- Name5
- Differences from canonical
- 15-15: Missing
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_054621 | 15 | in isoform 5 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_005404 | 122-206 | in isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_005405 | 122-256 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 147-160 | in Ref. 2 | ||||
Sequence: SHNEPGTAGSPRSQ → PLSSP | ||||||
Alternative sequence | VSP_005406 | 161 | in isoform 3 | |||
Sequence: V → G | ||||||
Alternative sequence | VSP_005407 | 162-256 | in isoform 3 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF242195 EMBL· GenBank· DDBJ | AAG09469.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF242195 EMBL· GenBank· DDBJ | AAG09470.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF242195 EMBL· GenBank· DDBJ | AAG09471.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF242195 EMBL· GenBank· DDBJ | AAG09472.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF243527 EMBL· GenBank· DDBJ | AAG33354.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X75363 EMBL· GenBank· DDBJ | CAA53145.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
CH471135 EMBL· GenBank· DDBJ | EAW71918.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC069480 EMBL· GenBank· DDBJ | AAH69480.1 EMBL· GenBank· DDBJ | mRNA | ||
BC069507 EMBL· GenBank· DDBJ | AAH69507.1 EMBL· GenBank· DDBJ | mRNA | ||
BC069518 EMBL· GenBank· DDBJ | AAH69518.1 EMBL· GenBank· DDBJ | mRNA | ||
BC126137 EMBL· GenBank· DDBJ | AAI26138.1 EMBL· GenBank· DDBJ | mRNA | ||
BC144046 EMBL· GenBank· DDBJ | AAI44047.1 EMBL· GenBank· DDBJ | mRNA |