Q9H190 · SDCB2_HUMAN
- ProteinSyntenin-2
- GeneSDCBP2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids292 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Binds phosphatidylinositol 4,5-bisphosphate (PIP2). May play a role in the organization of nuclear PIP2, cell division and cell survival (PubMed:15961997).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | extracellular exosome | |
Cellular Component | Golgi apparatus | |
Cellular Component | nuclear speck | |
Cellular Component | nucleolus | |
Cellular Component | nucleoplasm | |
Cellular Component | plasma membrane | |
Molecular Function | identical protein binding | |
Molecular Function | phosphatidylinositol-4,5-bisphosphate binding | |
Molecular Function | protein heterodimerization activity | |
Molecular Function | protein homodimerization activity | |
Biological Process | cell population proliferation | |
Biological Process | intracellular signal transduction | |
Biological Process | intracellular transport | |
Biological Process | nervous system development |
Keywords
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameSyntenin-2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9H190
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Associates with intracellular membranes and enriched in the apical region of the cell and in intracellular compartments (PubMed:11102519).
Colocalizes with TM4SF1 in the apical region of the cell (PubMed:11102519).
Predominantly targeted to nuclear PIP2 pools. Shuttles between several subcellular compartments (PubMed:15961997).
PIP2 plays an important role in the distribution of SDCBP2 (PubMed:23300061).
Colocalizes with TM4SF1 in the apical region of the cell (PubMed:11102519).
Predominantly targeted to nuclear PIP2 pools. Shuttles between several subcellular compartments (PubMed:15961997).
PIP2 plays an important role in the distribution of SDCBP2 (PubMed:23300061).
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 113 | Abolishes phosphatidylinositol 4,5-bisphosphate binding and targeting to plasma membrane, speckles and nucleoli; when associated with A-167; A-197 and A-244. Reduces phosphatidylinositol 4,5-bisphosphate binding and does not change subcellular localization; when associated with A-167. | ||||
Sequence: K → A | ||||||
Mutagenesis | 167 | Abolishes phosphatidylinositol 4,5-bisphosphate binding and targeting to plasma membrane, speckles and nucleoli; when associated with A-113; A-197 and A-244. Reduces phosphatidylinositol 4,5-bisphosphate binding and does not change subcellular localization; when associated with A-113. | ||||
Sequence: K → A | ||||||
Natural variant | VAR_053700 | 182 | in dbSNP:rs2273959 | |||
Sequence: V → M | ||||||
Natural variant | VAR_036544 | 191 | in a colorectal cancer sample; somatic mutation; dbSNP:rs35367003 | |||
Sequence: R → Q | ||||||
Mutagenesis | 197 | Abolishes phosphatidylinositol 4,5-bisphosphate binding and targeting to plasma membrane, speckles and nucleoli; when associated with A-113; A-167 and A-244. Reduces phosphatidylinositol 4,5-bisphosphate binding and does not change subcellular localization; when associated with A-244. | ||||
Sequence: K → A | ||||||
Natural variant | VAR_053701 | 223 | in dbSNP:rs1048621 | |||
Sequence: R → C | ||||||
Natural variant | VAR_053702 | 242 | in dbSNP:rs4814111 | |||
Sequence: G → R | ||||||
Mutagenesis | 244 | Abolishes phosphatidylinositol 4,5-bisphosphate binding and targeting to plasma membrane, speckles and nucleoli; when associated with A-113; A-167 and A-197. Reduces phosphatidylinositol 4,5-bisphosphate binding and does not change subcellular localization; when associated with A-197. | ||||
Sequence: K → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 407 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000184004 | 1-292 | UniProt | Syntenin-2 | |||
Sequence: MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQIPEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA | |||||||
Modified residue (large scale data) | 5 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 7 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 24 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Tissue specificity
Preferentially expressed in cells of the digestive tract (PubMed:11102519).
Low expression in skeletal muscle and kidney (PubMed:11102519).
Detected in differentiated keratinocytes of normal and malignant epithelium (PubMed:22623796).
In healthy skin, expression is localized in suprabasal epidermal layers (PubMed:22623796).
Low expression in skeletal muscle and kidney (PubMed:11102519).
Detected in differentiated keratinocytes of normal and malignant epithelium (PubMed:22623796).
In healthy skin, expression is localized in suprabasal epidermal layers (PubMed:22623796).
Induction
Down-regulated by HPV8 E6 papillomavirus (HPV) oncoprotein (at protein level).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Monomer and homodimer (PubMed:11152476, PubMed:23300061).
Interacts with SDCBP (PubMed:11152476).
Interacts with TM4SF1 (PubMed:11102519).
Interacts with SDCBP (PubMed:11152476).
Interacts with TM4SF1 (PubMed:11102519).
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 108-187 | PDZ 1 | ||||
Sequence: EIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDR | ||||||
Domain | 192-267 | PDZ 2 | ||||
Sequence: TVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSV |
Domain
Binds phosphatidylinositol 4,5-bisphosphate (PIP2) via its two PDZ domains. These domains target SDCBP2 to the plasma membranes and nucleoli, two PIP2-rich regions.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9H190-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsAlpha
- Length292
- Mass (Da)31,594
- Last updated2002-05-02 v2
- ChecksumE12536839E1CD91C
Q9H190-3
- Name3
- SynonymsBeta
- Differences from canonical
- 1-85: Missing
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_006352 | 1-85 | in isoform 3 | |||
Sequence: Missing | ||||||
Sequence conflict | 69 | in Ref. 2; CAC21716 | ||||
Sequence: Q → H |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF159228 EMBL· GenBank· DDBJ | AAF80369.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ292245 EMBL· GenBank· DDBJ | CAC21573.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ292244 EMBL· GenBank· DDBJ | CAC21716.1 EMBL· GenBank· DDBJ | mRNA | ||
AF131809 EMBL· GenBank· DDBJ | AAD20049.1 EMBL· GenBank· DDBJ | mRNA | ||
AL136531 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC002727 EMBL· GenBank· DDBJ | AAH02727.2 EMBL· GenBank· DDBJ | mRNA | Different initiation |