Q9H116 · GZF1_HUMAN
- ProteinGDNF-inducible zinc finger protein 1
- GeneGZF1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids711 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleolus | |
Cellular Component | nucleoplasm | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | DNA-binding transcription repressor activity, RNA polymerase II-specific | |
Molecular Function | metal ion binding | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | branching involved in ureteric bud morphogenesis | |
Biological Process | negative regulation of DNA-templated transcription | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | regulation of DNA-templated transcription |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGDNF-inducible zinc finger protein 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9H116
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Joint laxity, short stature, and myopia (JLSM)
- Note
- DescriptionAn autosomal recessive disease characterized by generalized joint laxity, joint dislocation, pectus carinatum, short stature, and severe myopia with retinal detachment.
- See alsoMIM:617662
Natural variants in JLSM
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_080250 | 289-711 | missing | in JLSM |
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 32 | Decreased repression activity. | ||||
Sequence: D → N | ||||||
Mutagenesis | 50 | Decreased repression activity. | ||||
Sequence: K → D | ||||||
Natural variant | VAR_064718 | 97 | found in a renal cell carcinoma sample; somatic mutation | |||
Sequence: A → V | ||||||
Natural variant | VAR_052735 | 190 | in dbSNP:rs3810574 | |||
Sequence: N → S | ||||||
Natural variant | VAR_059890 | 275 | in dbSNP:rs6048760 | |||
Sequence: Q → L | ||||||
Natural variant | VAR_024212 | 275 | in dbSNP:rs6048760 | |||
Sequence: Q → P | ||||||
Natural variant | VAR_059891 | 275 | in dbSNP:rs6048760 | |||
Sequence: Q → R | ||||||
Natural variant | VAR_080250 | 289-711 | in JLSM | |||
Sequence: Missing | ||||||
Natural variant | VAR_052736 | 318 | in dbSNP:rs6114068 | |||
Sequence: K → N | ||||||
Natural variant | VAR_052737 | 667 | in dbSNP:rs6048766 | |||
Sequence: D → N |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 855 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000047539 | 1-711 | UniProt | GDNF-inducible zinc finger protein 1 | |||
Sequence: MESGAVLLESKSSPFNLLHEMHELRLLGHLCDVTVSVEYQGVRKDFMAHKAVLAATSKFFKEVFLNEKSVDGTRTNVYLNEVQVADFASFLEFVYTAKVQVEEDRVQRMLEVAEKLKCLDLSETCFQLKKQMLESVLLELQNFSESQEVEVSSGSQVSAAPAPRASVATDGPHPSGLTDSLDYPGERASNGMSSDLPPKKSKDKLDKKKEVVKPPYPKIRRASGRLAGRKVFVEIPKKKYTRRLREQQKTAEGDVGDYRCPQDQSPDRVGTEMEQVSKNEGCQAGAELEELSKKAGPEEEEEEEEEDEEGEKKKSNFKCSICEKAFLYEKSFLKHSKHRHGVATEVVYRCDTCGQTFANRCNLKSHQRHVHSSERHFPCELCGKKFKRKKDVKRHVLQVHEGGGERHRCGQCGKGLSSKTALRLHERTHTGDRPYGCTECGARFSQPSALKTHMRIHTGEKPFVCDECGARFTQNHMLIYHKRCHTGERPFMCETCGKSFASKEYLKHHNRIHTGSKPFKCEVCFRTFAQRNSLYQHIKVHTGERPYCCDQCGKQFTQLNALQRHRRIHTGERPFMCNACGRTFTDKSTLRRHTSIHDKNTPWKSFLVIVDGSPKNDDGHKTEQPDEEYVSSKLSDKLLSFAENGHFHNLAAVQDTVPTMQENSSADTACKADDSVVSQDTLLATTISELSELTPQTDSMPTQLHSLSNME | |||||||
Modified residue (large scale data) | 180 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 265 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 271 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 542 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 613 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 613 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Induction
Gene expression databases
Organism-specific databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 31-103 | BTB | ||||
Sequence: CDVTVSVEYQGVRKDFMAHKAVLAATSKFFKEVFLNEKSVDGTRTNVYLNEVQVADFASFLEFVYTAKVQVEE | ||||||
Region | 153-220 | Disordered | ||||
Sequence: SGSQVSAAPAPRASVATDGPHPSGLTDSLDYPGERASNGMSSDLPPKKSKDKLDKKKEVVKPPYPKIR | ||||||
Compositional bias | 197-216 | Basic and acidic residues | ||||
Sequence: PPKKSKDKLDKKKEVVKPPY | ||||||
Region | 243-312 | Disordered | ||||
Sequence: RLREQQKTAEGDVGDYRCPQDQSPDRVGTEMEQVSKNEGCQAGAELEELSKKAGPEEEEEEEEEDEEGEK | ||||||
Zinc finger | 317-340 | C2H2-type 1 | ||||
Sequence: FKCSICEKAFLYEKSFLKHSKHRH | ||||||
Zinc finger | 348-371 | C2H2-type 2 | ||||
Sequence: YRCDTCGQTFANRCNLKSHQRHVH | ||||||
Zinc finger | 377-400 | C2H2-type 3 | ||||
Sequence: FPCELCGKKFKRKKDVKRHVLQVH | ||||||
Zinc finger | 407-429 | C2H2-type 4 | ||||
Sequence: HRCGQCGKGLSSKTALRLHERTH | ||||||
Zinc finger | 435-457 | C2H2-type 5 | ||||
Sequence: YGCTECGARFSQPSALKTHMRIH | ||||||
Zinc finger | 463-485 | C2H2-type 6 | ||||
Sequence: FVCDECGARFTQNHMLIYHKRCH | ||||||
Zinc finger | 491-513 | C2H2-type 7 | ||||
Sequence: FMCETCGKSFASKEYLKHHNRIH | ||||||
Zinc finger | 519-541 | C2H2-type 8 | ||||
Sequence: FKCEVCFRTFAQRNSLYQHIKVH | ||||||
Zinc finger | 547-569 | C2H2-type 9 | ||||
Sequence: YCCDQCGKQFTQLNALQRHRRIH | ||||||
Zinc finger | 575-597 | C2H2-type 10 | ||||
Sequence: FMCNACGRTFTDKSTLRRHTSIH |
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9H116-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length711
- Mass (Da)80,492
- Last updated2001-03-01 v1
- Checksum9209B850193BCF1A
Q9H116-4
- Name2
- Differences from canonical
- 1-491: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q5JXG1 | Q5JXG1_HUMAN | GZF1 | 48 |
Sequence caution
Features
Showing features for alternative sequence, compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_055933 | 1-491 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 197-216 | Basic and acidic residues | ||||
Sequence: PPKKSKDKLDKKKEVVKPPY | ||||||
Sequence conflict | 520 | in Ref. 2; BAG51726 | ||||
Sequence: K → R | ||||||
Sequence conflict | 628 | in Ref. 2; BAG51726 | ||||
Sequence: E → G | ||||||
Sequence conflict | 632 | in Ref. 2; BAB15134 | ||||
Sequence: S → P | ||||||
Sequence conflict | 694 | in Ref. 2; BAG51726 | ||||
Sequence: T → A |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB100265 EMBL· GenBank· DDBJ | BAC98464.1 EMBL· GenBank· DDBJ | mRNA | ||
AK025447 EMBL· GenBank· DDBJ | BAB15134.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK056159 EMBL· GenBank· DDBJ | BAB71107.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK056477 EMBL· GenBank· DDBJ | BAG51726.1 EMBL· GenBank· DDBJ | mRNA | ||
AK289814 EMBL· GenBank· DDBJ | BAF82503.1 EMBL· GenBank· DDBJ | mRNA | ||
AK293942 EMBL· GenBank· DDBJ | BAG57319.1 EMBL· GenBank· DDBJ | mRNA | ||
AK314599 EMBL· GenBank· DDBJ | BAG37170.1 EMBL· GenBank· DDBJ | mRNA | ||
AL096677 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471133 EMBL· GenBank· DDBJ | EAX10159.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471133 EMBL· GenBank· DDBJ | EAX10160.1 EMBL· GenBank· DDBJ | Genomic DNA |