Q9H079 · KTBL1_HUMAN
- ProteinKATNB1-like protein 1
- GeneKATNBL1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids304 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Regulates microtubule-severing activity of KATNAL1 in a concentration-dependent manner in vitro.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cleavage furrow | |
Cellular Component | cytoplasm | |
Cellular Component | katanin complex | |
Cellular Component | microtubule cytoskeleton | |
Cellular Component | midbody | |
Cellular Component | mitotic spindle | |
Cellular Component | mitotic spindle pole | |
Cellular Component | nucleolus | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | microtubule binding | |
Biological Process | cytoplasmic microtubule organization | |
Biological Process | positive regulation of cytoskeleton organization |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameKATNB1-like protein 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9H079
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes to the spindle poles only during mitosis. Sequestered to the nucleus during interphase.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 9 | Complete redistribution from the nucleus to the cytoplasm; when associated with A-10; A-11; A-26; A-27; A-28; A-71; A-72; A-73 and A-74. | ||||
Sequence: K → A | ||||||
Mutagenesis | 10 | Complete redistribution from the nucleus to the cytoplasm; when associated with A-9; A-11; A-26; A-27; A-28; A-71; A-72; A-73 and A-74. | ||||
Sequence: K → A | ||||||
Mutagenesis | 11 | Complete redistribution from the nucleus to the cytoplasm; when associated with A-9; A-10; A-26; A-27; A-28; A-71; A-72; A-73 and A-74. | ||||
Sequence: R → A | ||||||
Mutagenesis | 26 | Complete redistribution from the nucleus to the cytoplasm; when associated with A-9; A-10; A-11; A-27; A-28; A-71; A-72; A-73 and A-74. | ||||
Sequence: R → A | ||||||
Mutagenesis | 27 | Complete redistribution from the nucleus to the cytoplasm; when associated with A-9; A-10; A-11; A-26; A-28; A-71; A-72; A-73 and A-74. | ||||
Sequence: K → A | ||||||
Mutagenesis | 28 | Complete redistribution from the nucleus to the cytoplasm; when associated with A-9; A-10; A-11; A-26; A-27; A-71; A-72; A-73 and A-74. | ||||
Sequence: K → A | ||||||
Mutagenesis | 71 | Redistributes from the nucleus to both nucleus and cytoplasm; when associated with A-72; A-73 and A-74. Complete redistribution from the nucleus to the cytoplasm; when associated with A-9; A-10; A-11; A-26; A-27; A-28; A-72; A-73 and A-74. | ||||
Sequence: R → A | ||||||
Mutagenesis | 72 | Redistributes from the nucleus to both nucleus and cytoplasm; when associated with A-71; A-73 and A-74. Complete redistribution from the nucleus to the cytoplasm; when associated with A-9; A-10; A-11; A-26; A-27; A-28; A-71; A-73 and A-74. | ||||
Sequence: R → A | ||||||
Mutagenesis | 73 | Redistributes from the nucleus to both nucleus and cytoplasm; when associated with A-71; A-72 and A-74. Complete redistribution from the nucleus to the cytoplasm; when associated with A-9; A-10; A-11; A-26; A-27; A-28; A-71; A-72 and A-74. | ||||
Sequence: K → A | ||||||
Mutagenesis | 74 | Redistributes from the nucleus to both nucleus and cytoplasm; when associated with A-71; A-72 and A-73. Complete redistribution from the nucleus to the cytoplasm; when associated with A-9; A-10; A-11; A-26; A-27; A-28; A-71; A-72 and A-73. | ||||
Sequence: K → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 268 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000089981 | 1-304 | UniProt | KATNB1-like protein 1 | |||
Sequence: MASETHNVKKRNFCNKIEDHFIDLPRKKISNFTNKNMKEVKKSPKQLAAYINRTVGQTVKSPDKLRKVIYRRKKVHHPFPNPCYRKKQSPGSGGCDMANKENELACAGHLPEKLHHDSRTYLVNSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNMRLNVALTFWRKRSISELVAYLLRIEDLGVVVDCLPVLTNCLQEEKQYISLGCCVDLLPLVKSLLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIINDGNIQILKQQLSGLWEQENHLTLVPGYTGNIAKDVDAYLLQLH | |||||||
Modified residue | 61 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 61 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 89 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 135 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with KATNA1 and KATNAL1; these interactions are competed by KATNB1 which has a higher affinity for them.
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 26-33 | Nuclear localization signal 1 | ||||
Sequence: RKKISNFT | ||||||
Motif | 72-79 | Nuclear localization signal 2 | ||||
Sequence: RKKVHHPF |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length304
- Mass (Da)34,767
- Last updated2001-03-01 v1
- Checksum5F7515A3A95FEBBB
Computationally mapped potential isoform sequences
There are 9 potential isoforms mapped to this entry
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL136908 EMBL· GenBank· DDBJ | CAB66842.1 EMBL· GenBank· DDBJ | mRNA | ||
AK026210 EMBL· GenBank· DDBJ | BAB15394.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK293021 EMBL· GenBank· DDBJ | BAF85710.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471125 EMBL· GenBank· DDBJ | EAW92288.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC026234 EMBL· GenBank· DDBJ | AAH26234.1 EMBL· GenBank· DDBJ | mRNA | ||
BC111000 EMBL· GenBank· DDBJ | AAI11001.1 EMBL· GenBank· DDBJ | mRNA |