Q9GZP9 · DERL2_HUMAN
- ProteinDerlin-2
- GeneDERL2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids239 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal glycoproteins, but not that of misfolded nonglycoproteins. May act by forming a channel that allows the retrotranslocation of misfolded glycoproteins into the cytosol where they are ubiquitinated and degraded by the proteasome. May mediate the interaction between VCP and misfolded glycoproteins (PubMed:16186509, PubMed:16449189).
May also be involved in endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively attenuates the translocation of newly synthesized proteins into the endoplasmic reticulum and reroutes them to the cytosol for proteasomal degradation (PubMed:26565908).
May also be involved in endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively attenuates the translocation of newly synthesized proteins into the endoplasmic reticulum and reroutes them to the cytosol for proteasomal degradation (PubMed:26565908).
(Microbial infection) In contrast to DERL1, it is not involved in the degradation of MHC class I heavy chains following infection by cytomegaloviruses.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | early endosome | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | late endosome | |
Cellular Component | membrane | |
Molecular Function | protein-containing complex binding | |
Molecular Function | signal recognition particle binding | |
Biological Process | endoplasmic reticulum unfolded protein response | |
Biological Process | ERAD pathway | |
Biological Process | negative regulation of retrograde protein transport, ER to cytosol | |
Biological Process | positive regulation of cell growth | |
Biological Process | positive regulation of cell population proliferation | |
Biological Process | retrograde protein transport, ER to cytosol | |
Biological Process | suckling behavior |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameDerlin-2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9GZP9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-57 | Cytoplasmic | ||||
Sequence: MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRL | ||||||
Transmembrane | 58-78 | Helical; Name=1 | ||||
Sequence: ITNFLFFGPVGFNFLFNMIFL | ||||||
Topological domain | 79-96 | Lumenal | ||||
Sequence: YRYCRMLEEGSFRGRTAD | ||||||
Transmembrane | 97-117 | Helical; Name=2 | ||||
Sequence: FVFMFLFGGFLMTLFGLFVSL | ||||||
Topological domain | 118-150 | Cytoplasmic | ||||
Sequence: VFLGQAFTIMLVYVWSRRNPYVRMNFFGLLNFQ | ||||||
Transmembrane | 151-171 | Helical; Name=3 | ||||
Sequence: APFLPWVLMGFSLLLGNSIIV | ||||||
Topological domain | 172 | Lumenal | ||||
Sequence: D | ||||||
Transmembrane | 173-193 | Helical; Name=4 | ||||
Sequence: LLGIAVGHIYFFLEDVFPNQP | ||||||
Topological domain | 194-239 | Cytoplasmic | ||||
Sequence: GGIRILKTPSILKAIFDTPDEDPNYNPLPEERPGGFAWGEGQRLGG |
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 195 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000219045 | 1-239 | Derlin-2 | |||
Sequence: MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFLGQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQPGGIRILKTPSILKAIFDTPDEDPNYNPLPEERPGGFAWGEGQRLGG |
Proteomic databases
PTM databases
Expression
Tissue specificity
Ubiquitous. Overexpressed in various hepatocarcinomas.
Induction
Up-regulated in response to endoplasmic reticulum stress via the ERN1-XBP1 pathway of the unfolded protein response (UPR).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Forms homo- and heterooligomers with DERL3 and, to a lesser extent, with DERL1 (PubMed:16186509).
Interacts with the SEL1L/SYVN1 and VCP/SELENOS protein complexes (PubMed:16186509).
Mediates association between VCP and EDEM1, as well as that between VCP and the misfolded glycoproteins (PubMed:16449189).
Interacts with OS9 (PubMed:19084021).
Interacts with SELENOK and SELENOS (PubMed:22016385).
Interacts with the signal recognition particle/SRP and the SRP receptor; in the process of endoplasmic reticulum stress-induced pre-emptive quality control (PubMed:26565908).
Interacts with CCDC47 (By similarity).
Interacts with the SEL1L/SYVN1 and VCP/SELENOS protein complexes (PubMed:16186509).
Mediates association between VCP and EDEM1, as well as that between VCP and the misfolded glycoproteins (PubMed:16449189).
Interacts with OS9 (PubMed:19084021).
Interacts with SELENOK and SELENOS (PubMed:22016385).
Interacts with the signal recognition particle/SRP and the SRP receptor; in the process of endoplasmic reticulum stress-induced pre-emptive quality control (PubMed:26565908).
Interacts with CCDC47 (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9GZP9 | DIABLO Q9NR28 | 3 | EBI-7962814, EBI-517508 | |
BINARY | Q9GZP9 | FXYD6 Q9H0Q3 | 3 | EBI-7962814, EBI-713304 | |
BINARY | Q9GZP9 | KRTAP10-7 P60409 | 3 | EBI-7962814, EBI-10172290 | |
BINARY | Q9GZP9 | KRTAP10-8 P60410 | 3 | EBI-7962814, EBI-10171774 | |
BINARY | Q9GZP9 | MPP1 Q00013 | 3 | EBI-7962814, EBI-711788 | |
BINARY | Q9GZP9 | PTPN9 P43378 | 3 | EBI-7962814, EBI-742898 | |
BINARY | Q9GZP9 | RBFA Q8N0V3 | 3 | EBI-7962814, EBI-3232108 | |
BINARY | Q9GZP9 | RTN4 Q9NQC3 | 2 | EBI-7962814, EBI-715945 | |
BINARY | Q9GZP9 | SFT2D1 Q8WV19 | 3 | EBI-7962814, EBI-2854842 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 215-239 | Disordered | ||||
Sequence: DPNYNPLPEERPGGFAWGEGQRLGG |
Sequence similarities
Belongs to the derlin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length239
- Mass (Da)27,567
- Last updated2001-03-01 v1
- ChecksumCAA228487C3CCB5C
Computationally mapped potential isoform sequences
There are 7 potential isoforms mapped to this entry
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF132289 EMBL· GenBank· DDBJ | AAG43049.1 EMBL· GenBank· DDBJ | mRNA | ||
AF208065 EMBL· GenBank· DDBJ | AAL14869.1 EMBL· GenBank· DDBJ | mRNA | ||
AF151859 EMBL· GenBank· DDBJ | AAD34096.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AF242523 EMBL· GenBank· DDBJ | AAF99603.1 EMBL· GenBank· DDBJ | mRNA | ||
CR457202 EMBL· GenBank· DDBJ | CAG33483.1 EMBL· GenBank· DDBJ | mRNA | ||
BC010890 EMBL· GenBank· DDBJ | AAH10890.1 EMBL· GenBank· DDBJ | mRNA |