Q9GN62 · PAR4_CAEEL
- ProteinSerine/threonine-protein kinase par-4
- Genepar-4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids617 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required for cytoplasmic partitioning and asymmetric cell division in early embryogenesis (PubMed:10704392).
Controls the asymmetric cell division of the Q.p neuroblast lineage (PubMed:23267054).
Involved in mediating cell polarization via regulation of anillin family scaffold proteins (PubMed:21276723).
Phosphorylates and restricts the asymmetry effectors mex-5 and mex-6 to the anterior cytoplasm of the zygote and maintains these phosphorylations until fertilization (PubMed:18842813).
May phosphorylate par-1. Required for strd-1 localization to the cell cortex of early embryos and may be required for strd-1 protein stabilization. May regulate the integrity of the early embryonic cortex in a strd-1-dependent manner (PubMed:20110331).
Phosphorylates and regulates aak-2 in response to oxidative stress and during dauer development (PubMed:18408008, PubMed:20110331).
May also play a role in motility, behavioral response, regulation of lifespan and dauer formation through this pathway (PubMed:15574588, PubMed:18408008).
Required to establish germline stem cell (GSC) quiescence during dauer development (PubMed:20110331).
Acts downstream of unc-40 in dendrite outgrowth (PubMed:21186357).
May play a role in cell shedding during embryogenesis, probably by phosphorylating pig-1 (PubMed:22801495).
Controls the asymmetric cell division of the Q.p neuroblast lineage (PubMed:23267054).
Involved in mediating cell polarization via regulation of anillin family scaffold proteins (PubMed:21276723).
Phosphorylates and restricts the asymmetry effectors mex-5 and mex-6 to the anterior cytoplasm of the zygote and maintains these phosphorylations until fertilization (PubMed:18842813).
May phosphorylate par-1. Required for strd-1 localization to the cell cortex of early embryos and may be required for strd-1 protein stabilization. May regulate the integrity of the early embryonic cortex in a strd-1-dependent manner (PubMed:20110331).
Phosphorylates and regulates aak-2 in response to oxidative stress and during dauer development (PubMed:18408008, PubMed:20110331).
May also play a role in motility, behavioral response, regulation of lifespan and dauer formation through this pathway (PubMed:15574588, PubMed:18408008).
Required to establish germline stem cell (GSC) quiescence during dauer development (PubMed:20110331).
Acts downstream of unc-40 in dendrite outgrowth (PubMed:21186357).
May play a role in cell shedding during embryogenesis, probably by phosphorylating pig-1 (PubMed:22801495).
Catalytic activity
- ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
Cofactor
Mn2+ (UniProtKB | Rhea| CHEBI:29035 )
Features
Showing features for binding site, active site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cell cortex | |
Cellular Component | cytoplasm | |
Molecular Function | ATP binding | |
Molecular Function | calmodulin binding | |
Molecular Function | metal ion binding | |
Molecular Function | protein serine kinase activity | |
Molecular Function | protein serine/threonine kinase activity | |
Biological Process | asymmetric cell division | |
Biological Process | asymmetric neuroblast division | |
Biological Process | asymmetric protein localization involved in cell fate determination | |
Biological Process | cell differentiation | |
Biological Process | determination of adult lifespan | |
Biological Process | establishment of cell polarity | |
Biological Process | establishment or maintenance of cell polarity | |
Biological Process | positive regulation of dauer larval development | |
Biological Process | positive regulation of locomotion | |
Biological Process | regulation of actomyosin contractile ring contraction | |
Biological Process | response to oxidative stress |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSerine/threonine-protein kinase par-4
- EC number
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ9GN62
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Maternal effect lethality. Blastomeres cleave synchronously until the fourth or fifth round, when synchrony breaks down. Cells also fail to segregate P granules, with the posteriormost blastomere tending to contain more P granules than other blastomeres. Terminal stage embryos fail to produce intestinal cells. Adult worms exhibit temperature-dependent reduction of oxidative-stress induced aak-2 phosphorylation, hypersensitivity to oxidative stress, slow body bending, abnormal modulation of head oscillation, and partially suppress the lifespan extension and dauer-constitutive phenotypes of aak-2 mutants. Cytokinesis cell polarity defeats; mispositioning of anterior PAR proteins and defects in contractile ring ingression during cytokinesis due to abnormal actomyosin contractility. Shortened dendrites.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000383653 | 1-617 | Serine/threonine-protein kinase par-4 | |||
Sequence: MDAPSTSSGAQSKLLMPGDDEADEDHQNRGDPNLQQKQKIQLNVDPDYDDDEDDDCFIDGCEASAPITRELVDGAIERRSKDRNVKMSIGVYDEYDDDDDDEEETEEDQRRRFVEGIRNIRHKQQESFDLEEHPIPVESEAMRQFINQQVNNAMMFNQDNSEFQHIEFEPIVKQKGPKIIEGYMWGGQIGTGSYGKVKECIDMYTLTRRAVKIMKYDKLRKITNGWENIRSEMSILRRMNHRNVIKLIEIFNIPAKGKVYMVFEYCIGSVQQLLDMEPARRLTIGESHAIFIELCQGLNYLHSKRVSHKDIKPGNLLVSIDFTVKICDFGVAEQINLFQRDGRCTKVNGTPKFQPPECIYGNHDFFDGYKADMWSAGVTLYNLVSGKYPFEKPVLLKLYECIGTEPLQMPTNVQLTKDLQDLLTKLLEKDFNERPTCLETMIHPWFLSTFPEDQGLGRIMERMRTGDRPLTMLSSMTALYDGITPEDELIIEDNLGIIQQILPINLTSEAVLERGSFPGFKFLEAKPGDGPDGVEGSEDSAAPLGPQRRPSSRSMPTCAPPGPAAGNAQNSTAENGAETDGVASASDPPPTAAPGAPPRRRKRNFFSCIFRSRTDSA |
Proteomic databases
Expression
Tissue specificity
Expressed in the gonads, oocytes and early embryos (at protein level).
Developmental stage
Cortical distribution begins at the late 1-cell stage, is more pronounced at the 2- and 4-cell stages and is reduced at late stages of embryonic development.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-59 | Disordered | ||||
Sequence: MDAPSTSSGAQSKLLMPGDDEADEDHQNRGDPNLQQKQKIQLNVDPDYDDDEDDDCFID | ||||||
Compositional bias | 17-32 | Basic and acidic residues | ||||
Sequence: PGDDEADEDHQNRGDP | ||||||
Domain | 183-446 | Protein kinase | ||||
Sequence: YMWGGQIGTGSYGKVKECIDMYTLTRRAVKIMKYDKLRKITNGWENIRSEMSILRRMNHRNVIKLIEIFNIPAKGKVYMVFEYCIGSVQQLLDMEPARRLTIGESHAIFIELCQGLNYLHSKRVSHKDIKPGNLLVSIDFTVKICDFGVAEQINLFQRDGRCTKVNGTPKFQPPECIYGNHDFFDGYKADMWSAGVTLYNLVSGKYPFEKPVLLKLYECIGTEPLQMPTNVQLTKDLQDLLTKLLEKDFNERPTCLETMIHPWF | ||||||
Region | 523-617 | Disordered | ||||
Sequence: LEAKPGDGPDGVEGSEDSAAPLGPQRRPSSRSMPTCAPPGPAAGNAQNSTAENGAETDGVASASDPPPTAAPGAPPRRRKRNFFSCIFRSRTDSA | ||||||
Compositional bias | 564-579 | Polar residues | ||||
Sequence: AAGNAQNSTAENGAET |
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q9GN62-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Namea
- Length617
- Mass (Da)69,648
- Last updated2001-10-01 v2
- Checksum9E8451AE18BE5DCA
Q9GN62-2
- Nameb
- Differences from canonical
- 1-141: Missing
Q9GN62-3
- Namec
- Differences from canonical
- 161-164: Missing
Features
Showing features for alternative sequence, compositional bias.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF160189 EMBL· GenBank· DDBJ | AAD45355.1 EMBL· GenBank· DDBJ | mRNA | ||
AL132898 EMBL· GenBank· DDBJ | CAC14418.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL132863 EMBL· GenBank· DDBJ | CAC14418.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL132898 EMBL· GenBank· DDBJ | CCA65681.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL132863 EMBL· GenBank· DDBJ | CCA65681.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL132898 EMBL· GenBank· DDBJ | CCA65682.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL132863 EMBL· GenBank· DDBJ | CCA65682.1 EMBL· GenBank· DDBJ | Genomic DNA |