Q9FY89 · VP202_ARATH
- ProteinVacuolar protein sorting-associated protein 20 homolog 2
- GeneVPS20.2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids216 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-III complex is probably involved in the concentration of MVB cargo (By similarity).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | ESCRT III complex | |
Cellular Component | late endosome | |
Cellular Component | plasma membrane | |
Biological Process | intralumenal vesicle formation | |
Biological Process | protein transport | |
Biological Process | vacuolar transport |
Keywords
- Biological process
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameVacuolar protein sorting-associated protein 20 homolog 2
- Short namesAtVPS20-2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9FY89
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for initiator methionine, lipidation, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Lipidation | 2 | N-myristoyl glycine | ||||
Sequence: G | ||||||
Chain | PRO_0000368203 | 2-216 | Vacuolar protein sorting-associated protein 20 homolog 2 | |||
Sequence: GNLFVKKPKITEVDRAILSLKTQRRKLGQYQQQLEKVIEAEKQAARDLIREKRKDRALLALKKKRTQEELLKQVDQWLINVEQQLADIELTSKQKAVFESLKQGNNAIKAIQSEVNLDDVQKLMDDTAEAKAYQDELSAILGEKLSAEDEEEILAEFDNLESLLIVEDMPEVPTTELMPEEPEKMDLPDVPTKAPVASNETTSTKRKVLEEPLEA |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Component of the endosomal sorting required for transport complex III (ESCRT-III), composed at least of VPS2, VPS20, VPS24 and VPS32 (By similarity).
Interacts with SKD1 (PubMed:20663085).
Interacts with SKD1 (PubMed:20663085).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9FY89 | VPS20.1 Q8GXN6 | 4 | EBI-3865360, EBI-3865286 | |
BINARY | Q9FY89 | VPS25 Q8VZC9 | 7 | EBI-3865360, EBI-3865350 | |
BINARY | Q9FY89 | VPS32.1 O82197 | 3 | EBI-3865360, EBI-3865938 | |
BINARY | Q9FY89 | VPS32.2 Q9SZE4 | 3 | EBI-3865360, EBI-3865953 | |
BINARY | Q9FY89 | VPS36 Q9FF81 | 5 | EBI-3865360, EBI-3865302 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for coiled coil, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 16-90 | |||||
Sequence: RAILSLKTQRRKLGQYQQQLEKVIEAEKQAARDLIREKRKDRALLALKKKRTQEELLKQVDQWLINVEQQLADIE | ||||||
Region | 173-216 | Disordered | ||||
Sequence: VPTTELMPEEPEKMDLPDVPTKAPVASNETTSTKRKVLEEPLEA |
Sequence similarities
Belongs to the SNF7 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length216
- Mass (Da)24,609
- Last updated2001-03-01 v1
- Checksum710C1780459BDF72
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL391712 EMBL· GenBank· DDBJ | CAC05452.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED91366.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT010522 EMBL· GenBank· DDBJ | AAQ65145.1 EMBL· GenBank· DDBJ | mRNA | ||
AK175654 EMBL· GenBank· DDBJ | BAD43417.1 EMBL· GenBank· DDBJ | mRNA |