Q9FT81 · TT8_ARATH
- ProteinTranscription factor TT8
- GeneTT8
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids518 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription activator, when associated with MYB75/PAP1 or MYB90/PAP2. Involved in the control of flavonoid pigmentation. Plays a key role in regulating leucoanthocyanidin reductase (BANYULS) and dihydroflavonol-4-reductase (DFR). Not required for leucoanthocyanidin dioxygenase (LDOX) expression.
Miscellaneous
TT8 might interact with TT2 and TTG1 to modulate the late genes of the flavonoid pathway.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | protein dimerization activity | |
Molecular Function | transcription cis-regulatory region binding | |
Biological Process | flavonoid biosynthetic process | |
Biological Process | jasmonic acid mediated signaling pathway | |
Biological Process | positive regulation of anthocyanin biosynthetic process | |
Biological Process | regulation of flavonoid biosynthetic process | |
Biological Process | regulation of proanthocyanidin biosynthetic process | |
Biological Process | seed coat development | |
Biological Process | seed development | |
Biological Process | trichome differentiation |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTranscription factor TT8
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9FT81
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 268 | In tt8-1; loss of seed pigmentation. | ||||
Sequence: L → LDIYIYPKLLIFCGFISLYLRNYHLYIYV | ||||||
Natural variant | 307 | in strain: cv. Wassilewskija-2 | ||||
Sequence: S → Y |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 50 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000127431 | 1-518 | Transcription factor TT8 | |||
Sequence: MDESSIIPAEKVAGAEKKELQGLLKTAVQSVDWTYSVFWQFCPQQRVLVWGNGYYNGAIKTRKTTQPAEVTAEEAALERSQQLRELYETLLAGESTSEARACTALSPEDLTETEWFYLMCVSFSFPPPSGMPGKAYARRKHVWLSGANEVDSKTFSRAILAKSAKIQTVVCIPMLDGVVELGTTKKVREDVEFVELTKSFFYDHCKTNPKPALSEHSTYEVHEEAEDEEEVEEEMTMSEEMRLGSPDDEDVSNQNLHSDLHIESTHTLDTHMDMMNLMEEGGNYSQTVTTLLMSHPTSLLSDSVSTSSYIQSSFATWRVENGKEHQQVKTAPSSQWVLKQMIFRVPFLHDNTKDKRLPREDLSHVVAERRRREKLNEKFITLRSMVPFVTKMDKVSILGDTIAYVNHLRKRVHELENTHHEQQHKRTRTCKRKTSEEVEVSIIENDVLLEMRCEYRDGLLLDILQVLHELGIETTAVHTSVNDHDFEAEIRAKVRGKKASIAEVKRAIHQVIIHDTNL |
Proteomic databases
Expression
Tissue specificity
Buds, flowers and developing siliques, but not in leaves, stems and roots.
Developmental stage
Faint expression in buds and flowers. Increases during the very early stages of seed development, reaches a maximum at the globular embryo stage and stays high throughout seed formation.
Gene expression databases
Interaction
Subunit
Homodimer (Probable). Interacts with MYB4, MYB5, MYB6, MYB82, MYB113, MYB114, MYB75/PAP1, MYB90/PAP2, and TT2.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9FT81 | MYB114 Q9FNV8 | 3 | EBI-395790, EBI-1546262 | |
BINARY | Q9FT81 | MYB75 Q9FE25 | 5 | EBI-395790, EBI-1545177 | |
BINARY | Q9FT81 | MYB90 Q9ZTC3 | 2 | EBI-395790, EBI-1545203 | |
BINARY | Q9FT81 | MYBL2 Q9C9A5 | 3 | EBI-395790, EBI-1546577 | |
BINARY | Q9FT81 | TT2 Q9FJA2 | 5 | EBI-395790, EBI-395778 | |
BINARY | Q9FT81 | TTG1 Q9XGN1 | 5 | EBI-395790, EBI-395803 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for coiled coil, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 220-240 | |||||
Sequence: EVHEEAEDEEEVEEEMTMSEE | ||||||
Domain | 359-408 | bHLH | ||||
Sequence: REDLSHVVAERRRREKLNEKFITLRSMVPFVTKMDKVSILGDTIAYVNHL | ||||||
Coiled coil | 405-428 | |||||
Sequence: VNHLRKRVHELENTHHEQQHKRTR |
Sequence similarities
Belongs to the bHLH protein family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length518
- Mass (Da)59,198
- Last updated2002-12-13 v2
- Checksum25988482FE25C99C
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ277509 EMBL· GenBank· DDBJ | CAC14865.1 EMBL· GenBank· DDBJ | mRNA | ||
AL049482 EMBL· GenBank· DDBJ | CAB39649.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AL161516 EMBL· GenBank· DDBJ | CAB78105.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002687 EMBL· GenBank· DDBJ | AEE82802.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ446813 EMBL· GenBank· DDBJ | ABE66051.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ653187 EMBL· GenBank· DDBJ | ABK28624.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |