Q9FQ09 · KU80_ARATH
- ProteinATP-dependent DNA helicase 2 subunit KU80
- GeneKU80
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids680 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Single-stranded DNA-dependent ATP-dependent helicase. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair. When associated with KU70, binds to double-stranded telomeric and non-telomeric DNA sequences, but not to single-stranded DNA. Plays a role in maintaining telomere length. Acts as a negative regulator of telomerase. Binds to and recombines double-stranded T-DNA molecules.
Catalytic activity
- ATP + H2O = ADP + H+ + phosphate
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | Ku70:Ku80 complex | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | damaged DNA binding | |
Molecular Function | DNA helicase activity | |
Molecular Function | double-stranded DNA binding | |
Molecular Function | telomeric DNA binding | |
Biological Process | DNA integration | |
Biological Process | DNA recombination | |
Biological Process | DNA repair | |
Biological Process | double-strand break repair | |
Biological Process | double-strand break repair via nonhomologous end joining | |
Biological Process | response to heat | |
Biological Process | telomere maintenance |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameATP-dependent DNA helicase 2 subunit KU80
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9FQ09
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Phenotypes & Variants
Disruption phenotype
No visible phenotype when grown under normal conditions. Hypersensitivity to ionising radiation (IR) and to DNA-damaging agents. Longer telomeres. Defective in T-DNA integration.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 57 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000394131 | 1-680 | ATP-dependent DNA helicase 2 subunit KU80 | |||
Sequence: MARNREGLVLVLDVGPAMRSVLPDVEKACSMLLQKKLIYNKYDEVGIVVFGTEETGNELAREIGGYENVTVLRNIRVVDELAAEHVKQLPRGTVAGDFLDALIVGMDMLIKMYGNAHKGKKRMCLITNAACPTKDPFEGTKDDQVSTIAMKMAAEGIKMESIVMRSNLSGDAHERVIEENDHLLTLFSSNAIAKTVNVDSPLSLLGSLKTRRVAPVTLFRGDLEINPTMKIKVWVYKKVAEERLPTLKMYSDKAPPTDKFAKHEVKVDYDYKVTAESTEVIAPEERIKGFRYGPQVIPISPDQIETLKFKTDKGMKLLGFTEASNILRHYYMKDVNIVVPDPSKEKSVLAVSAIAREMKETNKVAIVRCVWRNGQGNVVVGVLTPNVSERDDTPDSFYFNVLPFAEDVREFPFPSFNKLPSSWKPDEQQQAVADNLVKMLDLAPSAEEEVLKPDLTPNPVLQRFYEYLELKSKSTDATLPPMDGTFKRLMEQDPELSSNNKSIMDTFRGSFEVKENPKLKKASKRLLRDKPSGSDDEDNRMITYDAKENKIDIVGDANPIQDFEAMISRRDKTDWTEKAITQMKNLIMKLVENCTDEGDKALECVLALRKGCVLEQEPKQFNEFLNHLFKLCQERNLSHLLEHFMSKKITLIPKSEAADSDIVDENAGDFIVKQESMLES |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed ubiquitously.
Induction
Up-regulated in response to induction of double-strand breaks. Down-regulated by heat shock.
Gene expression databases
Interaction
Subunit
Heterodimer with KU70. Interacts with WEX.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9FQ09 | WEX Q84LH3 | 2 | EBI-926593, EBI-926580 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 224-432 | Ku | ||||
Sequence: EINPTMKIKVWVYKKVAEERLPTLKMYSDKAPPTDKFAKHEVKVDYDYKVTAESTEVIAPEERIKGFRYGPQVIPISPDQIETLKFKTDKGMKLLGFTEASNILRHYYMKDVNIVVPDPSKEKSVLAVSAIAREMKETNKVAIVRCVWRNGQGNVVVGVLTPNVSERDDTPDSFYFNVLPFAEDVREFPFPSFNKLPSSWKPDEQQQAV |
Sequence similarities
Belongs to the ku80 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length680
- Mass (Da)76,688
- Last updated2001-03-01 v1
- ChecksumFA7C0191DF05A976
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8ASX4 | A0A1P8ASX4_ARATH | KU80 | 663 | ||
A0A1P8AT14 | A0A1P8AT14_ARATH | KU80 | 635 |
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF283758 EMBL· GenBank· DDBJ | AAG44851.1 EMBL· GenBank· DDBJ | mRNA | ||
AC023673 EMBL· GenBank· DDBJ | AAF79532.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AC051631 EMBL· GenBank· DDBJ | AAG51535.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002684 EMBL· GenBank· DDBJ | AEE32242.1 EMBL· GenBank· DDBJ | Genomic DNA |