Q9FNP0 · VQ31_ARATH
- ProteinVQ motif-containing protein 31
- GeneVQ31
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids173 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
May modulate WRKY transcription factor activities.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus |
Names & Taxonomy
Protein names
- Recommended nameVQ motif-containing protein 31
- Short namesAtVQ31
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9FNP0
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000432321 | 1-173 | VQ motif-containing protein 31 | |||
Sequence: MNSKGSQNVATTCKPVTTFVQTDTNTFREIVQRLTGPTENNAAAATPEATVIKTAIQKRPTSKLHERRQCMRPKLEIVKPPLSFKPTGTTPSSKSGNTNLLTSPVGTPSSLFSNLSLIEGEPDSCTTNIEEEEKAIKERRFYLHPSPRSKPGYTEPELLTLFPLTSPNSSGKP | ||||||
Modified residue | 46 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 92 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 103 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 146 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 149 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 165 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 166 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 170 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Phosphorylated on serine and threonine residues by MPK6.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9FNP0 | WRKY24 Q9FFS3 | 3 | EBI-25517821, EBI-4431481 | |
BINARY | Q9FNP0 | WRKY43 Q8GY11 | 3 | EBI-25517821, EBI-1235953 | |
BINARY | Q9FNP0 | WRKY56 Q8VWQ4 | 3 | EBI-25517821, EBI-25517688 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for motif, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 27-36 | VQ | ||||
Sequence: FREIVQRLTG | ||||||
Region | 76-105 | Disordered | ||||
Sequence: EIVKPPLSFKPTGTTPSSKSGNTNLLTSPV | ||||||
Compositional bias | 85-105 | Polar residues | ||||
Sequence: KPTGTTPSSKSGNTNLLTSPV | ||||||
Region | 143-173 | Disordered | ||||
Sequence: LHPSPRSKPGYTEPELLTLFPLTSPNSSGKP |
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9FNP0-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length173
- Mass (Da)18,899
- Last updated2001-03-01 v1
- ChecksumA2DF7C89A72F532E
Q9FNP0-2
- Name2
- Differences from canonical
- 88-118: Missing
Sequence caution
Features
Showing features for compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 85-105 | Polar residues | ||||
Sequence: KPTGTTPSSKSGNTNLLTSPV | ||||||
Alternative sequence | VSP_057494 | 88-118 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB006697 EMBL· GenBank· DDBJ | BAB09997.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED91308.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED91309.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | ANM68666.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ446932 EMBL· GenBank· DDBJ | ABE66143.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ446933 EMBL· GenBank· DDBJ | ABE66144.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ653274 EMBL· GenBank· DDBJ | ABK28690.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
BT026100 EMBL· GenBank· DDBJ | ABG48456.1 EMBL· GenBank· DDBJ | mRNA | ||
AY085562 EMBL· GenBank· DDBJ | AAM62784.1 EMBL· GenBank· DDBJ | mRNA |