Q9FN79 · BDG5_ARATH
- ProteinProbable lysophospholipase BODYGUARD 5
- GeneBDG5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids443 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Involved in cuticle development and morphogenesis.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 167 | |||||
Sequence: H | ||||||
Active site | 242 | Nucleophile | ||||
Sequence: S | ||||||
Active site | 387 | Charge relay system | ||||
Sequence: D | ||||||
Active site | 415 | Charge relay system | ||||
Sequence: H |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | plasma membrane | |
Molecular Function | hydrolase activity | |
Biological Process | cell wall organization |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameProbable lysophospholipase BODYGUARD 5
- EC number
- Short namesAtBDG5
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9FN79
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, lipidation, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-52 | |||||
Sequence: MITSSFSEKCTSVINGAPSWAVFFLFDLLDYFLCIVFRFLDEVMEEKSESCH | ||||||
Lipidation | 53 | N-palmitoyl cysteine | ||||
Sequence: C | ||||||
Chain | PRO_0000437272 | 53-443 | Probable lysophospholipase BODYGUARD 5 | |||
Sequence: CNNPREKTHFAEYEFLSETLYRRRNVFRQAGFLRFANKLPEITKKIGIVTFLRKFLFPHTMNKVSHEVANRWSDCGCKTCVSWINTDKLNVIVKQPSISDLSISNKPVENVIFVHGFLASSSFWTNTVFKYLPETTEGTNYRFFAIDLLGFGDSPKPRASQYSLKEHVEMIEKSVILPNNLTSFHVVAHSMGCIIGIALAAKFSDSVKSVALVAPPYFADSKGGASCAALDVVAKKKLWPPASFFTAMMCWYEHIGRGVCLVFCRHHRTWERIIKIVTWRRKLPTAIMDFTKHTHQSGWHSMHNVICGGAKFTDKHLETLIKSGVKINVMQGDKDVVVPIDCLSNMKGKFPAVEVEVIAGTDHSTVIMSRREVFAANLVSLWATSEKKQKV |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 163-268 | AB hydrolase-1 | ||||
Sequence: VIFVHGFLASSSFWTNTVFKYLPETTEGTNYRFFAIDLLGFGDSPKPRASQYSLKEHVEMIEKSVILPNNLTSFHVVAHSMGCIIGIALAAKFSDSVKSVALVAPP |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length443
- Mass (Da)50,180
- Last updated2001-03-01 v1
- Checksum023EF3503C837248
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB006706 EMBL· GenBank· DDBJ | BAB09571.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED92460.1 EMBL· GenBank· DDBJ | Genomic DNA |