Q9FMT4 · SNF12_ARATH
- ProteinSWI/SNF complex component SNF12 homolog
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids534 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Biological Process | chromatin organization | |
Biological Process | DNA repair | |
Biological Process | regulation of flower development | |
Biological Process | regulation of gene expression | |
Biological Process | regulation of leaf development | |
Biological Process | response to UV-B | |
Biological Process | root development |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSWI/SNF complex component SNF12 homolog
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9FMT4
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000220617 | 1-534 | SWI/SNF complex component SNF12 homolog | |||
Sequence: MSGNNNNPQKPQGSAPLPFGNPGMASASVPGNQGFAQSHMAANFQAQFQFSQAQALAHAQAQSKVQAQLQAQLQAQGMTMNQAQGSPGIGGLGPSSPSLTTPGSLNMKRFQQKPPMRPPGAPASNNTISPMRTMELTPAARKKKQKLPEKSLQERVAAILPESALYTQLLEFESRVDAALTRKKVDIQEALKNPPCIQKTLRIYVFNSFANQNNTIPGNPNADPPTWTLKIIGRILEDGVDPDQPGFVQKANPLHPKFSSFFKRVTVSLDQRLYPENPLIIWENARSPAPQEGFEIKRKGNQEFAASIRLEMNYVPEKFKLSTALMDVLGIEVETRPRIIAAIWHYVKARKLQNPNDPSFFNCDAALQKVFGEEKLKFTMVSQKISHHLSPPPPIHLEHKIKLSGNNPAVSACYDVLVDVPFPIQRDLNNLLANAEKNKEIEACDEAICAAIRKIHEHRRRRAFFLGFSQSPVEFINALIESQSKDLKVVAGEASRNAERERRSDFFNQPWVEDAVIRYLNRRPAAGNDGPGSW |
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Part of a SWI-SNF complex.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9FMT4 | GAI Q9LQT8 | 3 | EBI-3387100, EBI-963606 | |
BINARY | Q9FMT4 | GID1B Q9LYC1 | 3 | EBI-3387100, EBI-963686 | |
BINARY | Q9FMT4 | MYB73 O23160 | 3 | EBI-3387100, EBI-25506855 | |
BINARY | Q9FMT4 | RGA Q9SLH3 | 3 | EBI-3387100, EBI-963624 | |
BINARY | Q9FMT4 | RGL2 Q8GXW1 | 3 | EBI-3387100, EBI-963665 | |
BINARY | Q9FMT4 | RGL3 Q9LF53 | 3 | EBI-3387100, EBI-15681313 | |
BINARY | Q9FMT4 | TCP4 Q8LPR5 | 3 | EBI-3387100, EBI-15192325 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-33 | Disordered | ||||
Sequence: MSGNNNNPQKPQGSAPLPFGNPGMASASVPGNQ | ||||||
Compositional bias | 78-108 | Polar residues | ||||
Sequence: MTMNQAQGSPGIGGLGPSSPSLTTPGSLNMK | ||||||
Region | 78-132 | Disordered | ||||
Sequence: MTMNQAQGSPGIGGLGPSSPSLTTPGSLNMKRFQQKPPMRPPGAPASNNTISPMR | ||||||
Domain | 314-391 | SWIB/MDM2 | ||||
Sequence: YVPEKFKLSTALMDVLGIEVETRPRIIAAIWHYVKARKLQNPNDPSFFNCDAALQKVFGEEKLKFTMVSQKISHHLSP |
Sequence similarities
Belongs to the SMARCD family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length534
- Mass (Da)59,271
- Last updated2001-03-01 v1
- Checksum4231FF2324C18D9D
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 78-108 | Polar residues | ||||
Sequence: MTMNQAQGSPGIGGLGPSSPSLTTPGSLNMK |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB007650 EMBL· GenBank· DDBJ | BAB08296.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED91995.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT008892 EMBL· GenBank· DDBJ | AAP68331.1 EMBL· GenBank· DDBJ | mRNA | ||
AY065106 EMBL· GenBank· DDBJ | AAL38282.1 EMBL· GenBank· DDBJ | mRNA |