Q9FLN0 · GLIP1_ARATH
- ProteinGDSL esterase/lipase 1
- GeneGLIP1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids374 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Confers resistance to the necrotrophic fungus Alternaria brassicicola. Possesses lipase and antimicrobial activities that directly disrupt fungal spore integrity. Triggers systemic resistance, mostly by the ethylene-dependent pathway.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 44 | Nucleophile | ||||
Sequence: S | ||||||
Active site | 338 | Charge relay system | ||||
Sequence: D | ||||||
Active site | 341 | Charge relay system | ||||
Sequence: H |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Molecular Function | lipase activity | |
Biological Process | defense response to bacterium | |
Biological Process | defense response to fungus | |
Biological Process | induced systemic resistance, ethylene mediated signaling pathway | |
Biological Process | jasmonic acid and ethylene-dependent systemic resistance, ethylene mediated signaling pathway | |
Biological Process | lipid catabolic process | |
Biological Process | response to fungus | |
Biological Process | response to salicylic acid | |
Biological Process | systemic acquired resistance |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGDSL esterase/lipase 1
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9FLN0
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Secreted upon salicylic acid treatment.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
In the resistant cv. Columbia (glip1-1 and glip1-2), confers susceptibility to A.brassicicola.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 55 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-25 | |||||
Sequence: MENSQLVSITFLAYTIIISIGSINC | ||||||
Chain | PRO_0000367334 | 26-374 | GDSL esterase/lipase 1 | |||
Sequence: IDNNNLVTNQSALFVFGDSVFDAGNNNYIDTLSSVRSNYWPYGQTTFKSPTGRVSDGRLIPDFIAEYAWLPLIPPNLQPFNGNSQFAYGVNFASGGAGALVGTFSGLVINLRTQLNNFKKVEEMLRSKLGDAEGKRVISRAVYLFHIGLNDYQYPFTTNSSLFQSISNEKYVDYVVGNMTDVFKEVYNLGGRKFGILNTGPYDCAPASLVIDQTKIRSCFQPVTELINMHNEKLLNGLRRLNHELSGFKYALHDYHTSLSERMNDPSKYGFKEGKKACCGSGPLRGINTCGGRMGLSQSYELCENVTDYLFFDPFHLTEKANRQIAELIWSGPTNITGPYNLKALFELN | ||||||
Glycosylation | 34 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 184 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 203 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 330 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 360 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length374
- Mass (Da)41,706
- Last updated2001-03-01 v1
- Checksum3CF3297DEB910456
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB010072 EMBL· GenBank· DDBJ | BAB09701.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED94623.1 EMBL· GenBank· DDBJ | Genomic DNA |