Q9FKC8 · MT799_ARATH
- ProteinProbable S-adenosylmethionine-dependent methyltransferase At5g37990
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids362 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
Cofactor
Note: Binds 1 Mg2+ ion per subunit.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 19 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 19 | substrate | ||||
Sequence: Y | ||||||
Binding site | 22-26 | substrate | ||||
Sequence: NSSYQ | ||||||
Binding site | 65 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 65-66 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: GC | ||||||
Binding site | 71 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 105-108 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: FNDQ | ||||||
Binding site | 136-138 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: SFH | ||||||
Binding site | 153-155 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: TYA | ||||||
Binding site | 154-158 | substrate | ||||
Sequence: YALHW | ||||||
Binding site | 175 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 261 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 263 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: F |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | metal ion binding | |
Molecular Function | S-adenosylmethionine-dependent methyltransferase activity | |
Biological Process | methylation |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProbable S-adenosylmethionine-dependent methyltransferase At5g37990
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9FKC8
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000333027 | 1-362 | Probable S-adenosylmethionine-dependent methyltransferase At5g37990 | |||
Sequence: MPTFPQSFPMNGGDGPHSYIHNSSYQKVAIDGAKEKTSEAILKNLDLELLNRNSDENILRIADFGCSIGPNTFEVVQNIIDTVKQKNLKENNAYIGAPLEFQVCFNDQPNNDFNTLFRTQPISSKQAYLSVGVPGSFHGRVLPKNSLHIGHITYALHWLSTVPQHVCDKKSPALNKSYIQCNNLVEEVTEAYRVQFKKDMGDFLGARAEELVSGGLMILSGQCLPDGVPKALTWQGVVIDMIGDCLMDMAKQGITTKEKIELFSLPIYIPHISEFKAEIERNENFSIETMEKISHPMDYKPLTNDFITSMFRAILNTIIEEHFGDGVVNELFDRFAKKLNKYPIDFKRCKKYVNYFIVLKRK |
Proteomic databases
Expression
Gene expression databases
Interaction
Structure
Family & Domains
Sequence similarities
Belongs to the methyltransferase superfamily. Type-7 methyltransferase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length362
- Mass (Da)41,025
- Last updated2008-05-20 v2
- ChecksumCBB39C5FD6EADB02
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB012241 EMBL· GenBank· DDBJ | BAB09044.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
CP002688 EMBL· GenBank· DDBJ | AED94255.2 EMBL· GenBank· DDBJ | Genomic DNA |