Q9FF81 · VPS36_ARATH
- ProteinVacuolar protein sorting-associated protein 36
- GeneVPS36
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids440 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex (By similarity).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | early endosome | |
Cellular Component | ESCRT II complex | |
Cellular Component | late endosome | |
Cellular Component | plasma membrane | |
Molecular Function | phosphatidylinositol-3-phosphate binding | |
Molecular Function | ubiquitin binding | |
Biological Process | embryo development ending in seed dormancy | |
Biological Process | endosome transport via multivesicular body sorting pathway | |
Biological Process | multivesicular body sorting pathway | |
Biological Process | protein transport | |
Biological Process | seedling development | |
Biological Process | vacuole organization |
Keywords
- Biological process
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameVacuolar protein sorting-associated protein 36
- Short namesAtVPS36
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9FF81
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000368194 | 1-440 | Vacuolar protein sorting-associated protein 36 | |||
Sequence: MASGSSSIAIGGLFENAEVTTSGRPVLRRNEVECFLLSSIDIDSEDDPPRFTALRSGNLILTTHRLIWIPSQSNESVPSSIPLSAVTHIYSHKKSIKSMFHSPRIRFQADPGSIVVTIVFRGKGDFDGFLSKLWECWRGRAWEEEEKSESETSKSGSGTVAQGLYGNDGTVRMVGLAGILRKEQEQWESTDKSLQDAFQDLNALMSKAKEMVSLAEKMRQKLLSAPSSQNGSTDDEEMGSKEEMQQWMLSVGIISPVTKESAGALYHQELSRQLADFVRIPLEKAGGMISLTDMYYHFNRARGTELISPDDLWQACTLWEKFDVPVMLRKFDSGVMVIQNKSHSDEEVMSRIRMLVTKTETLRVGVTASDAALTLKIAPAMAKEHLLSAETKGLLCRDMSPDGLRFYFNLFPEIDPTNLHIVKEFGTYGEWIKATSLLSV |
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Component of the endosomal sorting required for transport complex II (ESCRT-II), composed of VPS22, VPS25 and VPS36.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9FF81 | ELC Q9LHG8 | 3 | EBI-3865302, EBI-3865248 | |
BINARY | Q9FF81 | VPS2.1 Q9SKI2 | 3 | EBI-3865302, EBI-3865345 | |
BINARY | Q9FF81 | VPS20.1 Q8GXN6 | 5 | EBI-3865302, EBI-3865286 | |
BINARY | Q9FF81 | VPS20.2 Q9FY89 | 5 | EBI-3865302, EBI-3865360 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 17-97 | GLUE N-terminal | ||||
Sequence: AEVTTSGRPVLRRNEVECFLLSSIDIDSEDDPPRFTALRSGNLILTTHRLIWIPSQSNESVPSSIPLSAVTHIYSHKKSIK | ||||||
Domain | 115-149 | GLUE C-terminal | ||||
Sequence: VVTIVFRGKGDFDGFLSKLWECWRGRAWEEEEKSE | ||||||
Region | 144-163 | Disordered | ||||
Sequence: EEEKSESETSKSGSGTVAQG | ||||||
Coiled coil | 192-212 | |||||
Sequence: KSLQDAFQDLNALMSKAKEMV |
Sequence similarities
Belongs to the VPS36 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length440
- Mass (Da)49,034
- Last updated2001-03-01 v1
- Checksum25146E6B9F39FF75
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB005245 EMBL· GenBank· DDBJ | BAB11514.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED90804.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY072089 EMBL· GenBank· DDBJ | AAL59912.1 EMBL· GenBank· DDBJ | mRNA | ||
AY096570 EMBL· GenBank· DDBJ | AAM20220.1 EMBL· GenBank· DDBJ | mRNA | ||
AK228715 EMBL· GenBank· DDBJ | BAF00617.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |