Q9ES54 · NPL4_RAT
- ProteinNuclear protein localization protein 4 homolog
- GeneNploc4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids608 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
The ternary complex containing UFD1, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope (PubMed:10811609, PubMed:11740563, PubMed:11781570, PubMed:12411482, PubMed:12644454, PubMed:14636562).
Acts as a negative regulator of type I interferon production via the complex formed with VCP and UFD1, which binds to RIGI and recruits RNF125 to promote ubiquitination and degradation of RIGI (By similarity).
Acts as a negative regulator of type I interferon production via the complex formed with VCP and UFD1, which binds to RIGI and recruits RNF125 to promote ubiquitination and degradation of RIGI (By similarity).
Pathway
Protein degradation; proteasomal ubiquitin-dependent pathway.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Cellular Component | UFD1-NPL4 complex | |
Cellular Component | VCP-NPL4-UFD1 AAA ATPase complex | |
Molecular Function | ATPase binding | |
Molecular Function | metal ion binding | |
Molecular Function | protein-containing complex binding | |
Molecular Function | ubiquitin binding | |
Molecular Function | ubiquitin protein ligase binding | |
Biological Process | ERAD pathway | |
Biological Process | Golgi organization | |
Biological Process | negative regulation of RIG-I signaling pathway | |
Biological Process | negative regulation of type I interferon production | |
Biological Process | proteasome-mediated ubiquitin-dependent protein catabolic process | |
Biological Process | retrograde protein transport, ER to cytosol | |
Biological Process | ubiquitin-dependent protein catabolic process |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNuclear protein localization protein 4 homolog
- Short namesProtein NPL4
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ9ES54
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Associated with the endoplasmic reticulum and nuclear.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylalanine | ||||
Sequence: A | ||||||
Chain | PRO_0000057943 | 2-608 | Nuclear protein localization protein 4 homolog | |||
Sequence: AESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSSKSLHLLKIKHGDLLFLFPSSLAGPSSEMETSTSVGLKAFGAPHVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKAEVVDEIASKLGLRKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSSEECITAGDFQNKHPNICRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVRTRNEELAQTWKKSEQWATIEQLCSTVGVQLPGLHEFGAVGGSARAATSAMWACQHCTFMNQPGTGHCEMCSLPRT | ||||||
Modified residue | 179 | N6-acetyllysine | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Heterodimer with UFD1 (PubMed:10811609, PubMed:12644454).
The heterodimer binds ubiquitinated proteins (PubMed:12644454).
The heterodimer binds to VCP and inhibits Golgi membrane fusion (PubMed:10811609, PubMed:12644454).
Interacts with ZFAND2B; probably through VCP (By similarity).
The heterodimer binds ubiquitinated proteins (PubMed:12644454).
The heterodimer binds to VCP and inhibits Golgi membrane fusion (PubMed:10811609, PubMed:12644454).
Interacts with ZFAND2B; probably through VCP (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9ES54 | Ufd1 Q9ES53 | 6 | EBI-1993990, EBI-399031 | |
XENO | Q9ES54 | Ufd1 P70362 | 18 | EBI-1993990, EBI-7961331 | |
XENO | Q9ES54 | Vcp Q01853 | 11 | EBI-1993990, EBI-80597 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 226-363 | MPN | ||||
Sequence: IMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKAEVVDEIASKLGLRKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSSEECITAGDFQNKHPNICRLSPDGHF | ||||||
Zinc finger | 580-608 | RanBP2-type | ||||
Sequence: TSAMWACQHCTFMNQPGTGHCEMCSLPRT |
Domain
Binds ubiquitinated proteins via its RanBP2-type zinc finger.
Sequence similarities
Belongs to the NPL4 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length608
- Mass (Da)68,056
- Last updated2007-01-23 v3
- ChecksumF6F57DDEA53594A3
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0G2JU66 | A0A0G2JU66_RAT | Nploc4 | 608 | ||
A0A8I5ZTJ3 | A0A8I5ZTJ3_RAT | Nploc4 | 576 | ||
F1LQX9 | F1LQX9_RAT | Nploc4 | 607 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF234600 EMBL· GenBank· DDBJ | AAG27534.1 EMBL· GenBank· DDBJ | mRNA | ||
BC101887 EMBL· GenBank· DDBJ | AAI01888.1 EMBL· GenBank· DDBJ | mRNA |