Q9ES46 · PARVB_MOUSE
- ProteinBeta-parvin
- GeneParvb
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids365 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Adapter protein that plays a role in integrin signaling via ILK and in activation of the GTPases CDC42 and RAC1 by guanine exchange factors, such as ARHGEF6. Is involved in the reorganization of the actin cytoskeleton and formation of lamellipodia. Plays a role in cell adhesion, cell spreading, establishment or maintenance of cell polarity, and cell migration (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | actin cytoskeleton | |
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | focal adhesion | |
Cellular Component | lamellipodium | |
Cellular Component | plasma membrane | |
Cellular Component | Z disc | |
Molecular Function | actin binding | |
Biological Process | actin cytoskeleton organization | |
Biological Process | cell projection assembly | |
Biological Process | establishment or maintenance of cell polarity | |
Biological Process | establishment or maintenance of cell polarity regulating cell shape | |
Biological Process | lamellipodium assembly | |
Biological Process | substrate adhesion-dependent cell spreading |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameBeta-parvin
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9ES46
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Peripheral membrane protein
Note: Constituent of focal adhesions. Detected at the tips of the leading edge of cells. Colocalizes with F-actin at the tips of lamellipodia (By similarity).
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000121584 | 1-365 | Beta-parvin | |||
Sequence: MSSAPPRSPTPRAPKMKKDESFLGKLGGTLARKKKTREVTDLQEEGKSAINSPMAPALVDIHPEDTQLEENEERTMIDPTSREDPKFKELVKVLLDWINDVLAEERIIVKQLEEDLYDGQVLQKLLEKLAHCKLNVAEVTQSEIGQKQKLQTVLEAVQDLLRPHGWPLRWNVDSIHGKNLVAILHLLVSLAMHFRAPIHLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEIMMGRFERDAFDTLFDHAPDKLNLVKKSLITFVNKHLNKLNLEVTDLETQFADGVYLVLLLGLLEDYFVPLHNFYLTPDSFDQKVHNVAFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYTLFTKYKDVE | ||||||
Modified residue | 8 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Phosphorylated by ILK.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed predominantly in heart and moderately in spleen, lung and skeletal muscle.
Gene expression databases
Interaction
Subunit
Interacts with ILK, ARHGEF6, PXN (via LD motifs), ACTN2 and actin (By similarity).
Interacts with DYSF
Interacts with DYSF
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9ES46 | Arhgef7 Q9ES28 | 2 | EBI-6914996, EBI-642580 | |
BINARY | Q9ES46 | Capn3 Q64691 | 3 | EBI-6914996, EBI-21927513 | |
BINARY | Q9ES46 | Ilk O55222 | 3 | EBI-6914996, EBI-6690138 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-52 | Disordered | ||||
Sequence: MSSAPPRSPTPRAPKMKKDESFLGKLGGTLARKKKTREVTDLQEEGKSAINS | ||||||
Domain | 88-195 | Calponin-homology (CH) 1 | ||||
Sequence: KELVKVLLDWINDVLAEERIIVKQLEEDLYDGQVLQKLLEKLAHCKLNVAEVTQSEIGQKQKLQTVLEAVQDLLRPHGWPLRWNVDSIHGKNLVAILHLLVSLAMHFR | ||||||
Domain | 255-362 | Calponin-homology (CH) 2 | ||||
Sequence: NLVKKSLITFVNKHLNKLNLEVTDLETQFADGVYLVLLLGLLEDYFVPLHNFYLTPDSFDQKVHNVAFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYTLFTKYK |
Sequence similarities
Belongs to the parvin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length365
- Mass (Da)41,669
- Last updated2001-03-01 v1
- ChecksumA3C6B8B3D5875CEA
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F2Z417 | F2Z417_MOUSE | Parvb | 93 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF237770 EMBL· GenBank· DDBJ | AAG27172.1 EMBL· GenBank· DDBJ | mRNA |