Q9ERE2 · KRT81_MOUSE
- ProteinKeratin, type II cuticular Hb1
- GeneKrt81
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids481 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
Miscellaneous
There are two types of hair/microfibrillar keratin, I (acidic) and II (neutral to basic).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | keratin filament | |
Molecular Function | structural constituent of skin epidermis | |
Biological Process | intermediate filament organization | |
Biological Process | keratinization |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameKeratin, type II cuticular Hb1
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9ERE2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000361690 | 1-481 | Keratin, type II cuticular Hb1 | |||
Sequence: MTCGSGFCGRAFSCASACGPRPGRCCISAAPYRGISCYRGLSGGFGSQSVCGAFRSGSCGRSFGYRSGGICGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKHEEKEQIKCLNSKFAAFIDKVRFLEQQNKLLETKWQFYQNRKCCESNMEPLFEGYIEALRREAECVEADSGRLAAELNHAQESMEGYKKRYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANAEALTQETDFLRRMYDEETRILHSHISDTSIVVKMDNSRDLNMDCVVAEIKAQYDDIASRSRAEAESWYRTKCEEIKATVIRHGETLRRTREEINELNRMIQRLTAEIENAKCQNTKLEAAVTQSEQQGEAALADARCKLAELEGALQKAKQDMACLLKEYQEVMNSKLGLDVEITTYRRLLEGEEQRLCEGVGAVNVCVSSSRGGVVCGDLCVSGSRPVIGSACSAPCSGNLAVNTGLCAPCGSAVSCGRKC | ||||||
Cross-link | 212 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-106 | Head | ||||
Sequence: MTCGSGFCGRAFSCASACGPRPGRCCISAAPYRGISCYRGLSGGFGSQSVCGAFRSGSCGRSFGYRSGGICGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKHEE | ||||||
Domain | 106-417 | IF rod | ||||
Sequence: EKEQIKCLNSKFAAFIDKVRFLEQQNKLLETKWQFYQNRKCCESNMEPLFEGYIEALRREAECVEADSGRLAAELNHAQESMEGYKKRYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANAEALTQETDFLRRMYDEETRILHSHISDTSIVVKMDNSRDLNMDCVVAEIKAQYDDIASRSRAEAESWYRTKCEEIKATVIRHGETLRRTREEINELNRMIQRLTAEIENAKCQNTKLEAAVTQSEQQGEAALADARCKLAELEGALQKAKQDMACLLKEYQEVMNSKLGLDVEITTYRRLLEGEEQRL | ||||||
Region | 107-141 | Coil 1A | ||||
Sequence: KEQIKCLNSKFAAFIDKVRFLEQQNKLLETKWQFY | ||||||
Region | 142-151 | Linker 1 | ||||
Sequence: QNRKCCESNM | ||||||
Region | 152-252 | Coil 1B | ||||
Sequence: EPLFEGYIEALRREAECVEADSGRLAAELNHAQESMEGYKKRYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANAEALTQETDFLRRMYDEETRILHS | ||||||
Region | 253-269 | Linker 12 | ||||
Sequence: HISDTSIVVKMDNSRDL | ||||||
Region | 270-413 | Coil 2 | ||||
Sequence: NMDCVVAEIKAQYDDIASRSRAEAESWYRTKCEEIKATVIRHGETLRRTREEINELNRMIQRLTAEIENAKCQNTKLEAAVTQSEQQGEAALADARCKLAELEGALQKAKQDMACLLKEYQEVMNSKLGLDVEITTYRRLLEGE | ||||||
Region | 414-481 | Tail | ||||
Sequence: EQRLCEGVGAVNVCVSSSRGGVVCGDLCVSGSRPVIGSACSAPCSGNLAVNTGLCAPCGSAVSCGRKC |
Sequence similarities
Belongs to the intermediate filament family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length481
- Mass (Da)52,863
- Last updated2013-10-16 v2
- ChecksumDEF13B624C76C80A
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC103674 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC157583 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AF312018 EMBL· GenBank· DDBJ | AAG34120.1 EMBL· GenBank· DDBJ | mRNA |