Q9EQP6 · ARRC_MOUSE
- ProteinArrestin-C
- GeneArr3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids381 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May play a role in an as yet undefined retina-specific signal transduction. Could bind to photoactivated-phosphorylated red/green opsins.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | photoreceptor inner segment | |
Cellular Component | photoreceptor outer segment | |
Cellular Component | synapse | |
Molecular Function | G protein-coupled receptor binding | |
Molecular Function | opsin binding | |
Molecular Function | phosphoprotein binding | |
Molecular Function | protein domain specific binding | |
Biological Process | endocytosis | |
Biological Process | G protein-coupled receptor internalization | |
Biological Process | regulation of protein phosphorylation | |
Biological Process | signal transduction | |
Biological Process | visual perception |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameArrestin-C
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9EQP6
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000205204 | 1-381 | Arrestin-C | |||
Sequence: MSTVFKKTSSNGKFSIYLGKRDFVDDVDTVEPIDGVVLVDPEYLEGRKLFVRLTCAFRYGRDDLDVIGLTFRKDLYVQTKQVAPAEPTSIQGPLTALQERLLHKLGVNAYPFTLQMVANLPCSVTLQPGPEDSGKPCGVDFEVKSFCAENLEEKIPKSDSVQLVVRKVQFSALEPGPGPSAQTIRSFFLSSQPLQLQAWMDREVHYHGEAISVHVSINNYTNKVIRRIKIAVVQTTDVVLYSLDKYTKTVFVQEFTETVAANSSFSQTFAVTPLLAANCQKQGLALDGKLKHEDTNLASSTILRPGMNKELLGILVSYKVRVNLVVSYGGILGGLPASDVGVELPVILIHPKPSPGERAVATSSEDIVIEEFMQHNSQTQS |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Inner and outer segments, and the inner plexiform regions of the retina.
Developmental stage
At postnatal day 11 (P11) expressed in the soma and photoreceptor processes of the retinal inner segment, outer segment, outer plexiform layer, and inner plexiform layer. Expression in the inner plexiform layer is lost at P22.
Gene expression databases
Interaction
Subunit
Homodimer; disulfide-linked in response to retinal illumination (By similarity).
Interacts with CXCR4; the interaction is dependent on the C-terminal phosphorylation of CXCR4 and modulates the calcium ion mobilization activity of CXCR4 (By similarity).
Interacts with GPR84 (By similarity).
Interacts with CXCR4; the interaction is dependent on the C-terminal phosphorylation of CXCR4 and modulates the calcium ion mobilization activity of CXCR4 (By similarity).
Interacts with GPR84 (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length381
- Mass (Da)41,921
- Last updated2001-03-01 v1
- Checksum3BEAC282EC438920
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E9PXD3 | E9PXD3_MOUSE | Arr3 | 115 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF156979 EMBL· GenBank· DDBJ | AAG38954.1 EMBL· GenBank· DDBJ | mRNA |