Q9EQM3 · NKX24_MOUSE
- ProteinHomeobox protein Nkx-2.4
- GeneNkx2-4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids354 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Probable transcription factor.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 188-247 | Homeobox | ||||
Sequence: RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQA |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Biological Process | cell differentiation | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameHomeobox protein Nkx-2.4
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9EQM3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000048936 | 1-354 | Homeobox protein Nkx-2.4 | |||
Sequence: MSLSPKHTTPFSVSDILSPIEETYKKFGGVMDGAPPGLGAPLGAAAYRAPPSGPSSQAAAVAAGMQPPHAMAGHNAAAAAAAAAAAAAAAATYHMPPGVSQFPHSAMGSYCNGGLGNMGELPAYTDGMRGGAAAAATGWYGANTDPRYSSISRFMGPSAGVNVAGMGSLTGIADAAKSLAPLHAAAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQLQQEGGLGPPPPPPPPSPRRVAVPVLVKDGKPCQNGAGTPTPGQGGQQPQAPTPAPELEELSPSPPALHGPGGGLAALDAATGDYGGGVLGANLLYGRTW |
Proteomic databases
PTM databases
Expression
Tissue specificity
In the embryo it is detected in the posterior hypothalamus and later in the head. In the adult it is detected only in testis.
Developmental stage
Expressed in a restricted region of the posterior hypothalamus from 10 dpc. Detected in the head region from 12.5 dpc to 14.5 dpc. Expression is down-regulated by 15.5 dpc.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 245-329 | Disordered | ||||
Sequence: RQAKDKAAQQLQQEGGLGPPPPPPPPSPRRVAVPVLVKDGKPCQNGAGTPTPGQGGQQPQAPTPAPELEELSPSPPALHGPGGGL | ||||||
Compositional bias | 260-275 | Pro residues | ||||
Sequence: GLGPPPPPPPPSPRRV | ||||||
Compositional bias | 291-305 | Polar residues | ||||
Sequence: AGTPTPGQGGQQPQA |
Sequence similarities
Belongs to the NK-2 homeobox family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length354
- Mass (Da)36,225
- Last updated2003-01-27 v2
- ChecksumA7A0F450DB15616C
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 260-275 | Pro residues | ||||
Sequence: GLGPPPPPPPPSPRRV | ||||||
Compositional bias | 291-305 | Polar residues | ||||
Sequence: AGTPTPGQGGQQPQA |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF202038 EMBL· GenBank· DDBJ | AAG35618.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF202039 EMBL· GenBank· DDBJ | AAG35619.1 EMBL· GenBank· DDBJ | mRNA | ||
AL928876 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |