Q9DGC9 · GON2_ORYLA
- ProteinProgonadoliberin-2
- Genegnrh2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Stimulates the secretion of gonadotropins.
Miscellaneous
Teleost species possess three paralogous GnRHs: mdGnRH and cGnRH-II have been identified in tetrapods; sGnRH has no tetrapod ortholog and is thought to be a duplication of cGnRH-II.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Molecular Function | gonadotropin hormone-releasing hormone activity | |
Molecular Function | gonadotropin-releasing hormone receptor binding |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameProgonadoliberin-2
- Alternative names
- Cleaved into 2 chains
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Neoteleostei > Acanthomorphata > Ovalentaria > Atherinomorphae > Beloniformes > Adrianichthyidae > Oryziinae > Oryzias
Accessions
- Primary accessionQ9DGC9
- Secondary accessions
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for signal, modified residue, peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MSRLVLLLGVLLYVGAQLSQA | ||||||
Modified residue | 22 | Pyrrolidone carboxylic acid | ||||
Sequence: Q | ||||||
Peptide | PRO_0000012491 | 22-31 | Gonadoliberin-2 | |||
Sequence: QHWSHGWYPG | ||||||
Chain | PRO_0000012490 | 22-80 | Progonadoliberin-2 | |||
Sequence: QHWSHGWYPGGKRELDSFEVSEEMKLCETGECSYMRPQRRSFLRNIVLDALARELQKRK | ||||||
Modified residue | 31 | Glycine amide | ||||
Sequence: G | ||||||
Peptide | PRO_0000012492 | 35-80 | GnRH-associated peptide 2 | |||
Sequence: ELDSFEVSEEMKLCETGECSYMRPQRRSFLRNIVLDALARELQKRK |
Keywords
- PTM
Expression
Tissue specificity
Expressed in the cell bodies of a cluster of neurons in the midbrain tegmentum.
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Sequence similarities
Belongs to the GnRH family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length80
- Mass (Da)9,311
- Last updated2001-03-01 v1
- ChecksumCAE8F1B06B9AF26E
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 50 | in Ref. 2; BAC06423 | ||||
Sequence: T → A | ||||||
Sequence conflict | 55 | in Ref. 2; BAC06423 | ||||
Sequence: Y → F | ||||||
Sequence conflict | 62 | in Ref. 2; BAC06423 | ||||
Sequence: S → N | ||||||
Sequence conflict | 71 | in Ref. 2; BAC06423 | ||||
Sequence: A → T |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB041330 EMBL· GenBank· DDBJ | BAB16300.1 EMBL· GenBank· DDBJ | mRNA | ||
AB041334 EMBL· GenBank· DDBJ | BAC06417.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB074500 EMBL· GenBank· DDBJ | BAC06423.1 EMBL· GenBank· DDBJ | Genomic DNA |