Q9DCN2 · NB5R3_MOUSE
- ProteinNADH-cytochrome b5 reductase 3
- GeneCyb5r3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids301 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Catalyzes the reduction of two molecules of cytochrome b5 using NADH as the electron donor.
Catalytic activity
- 2 Fe(III)-[cytochrome b5] + NADH = 2 Fe(II)-[cytochrome b5] + H+ + NAD+This reaction proceeds in the forward direction.
Cofactor
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 92 | FAD (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 93 | FAD (UniProtKB | ChEBI) | ||||
Sequence: P | ||||||
Binding site | 94 | FAD (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 109 | FAD (UniProtKB | ChEBI) | ||||
Sequence: V | ||||||
Binding site | 111 | FAD (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 114 | FAD (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 126 | FAD (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 127 | FAD (UniProtKB | ChEBI) | ||||
Sequence: M | ||||||
Binding site | 128 | FAD (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 185 | FAD (UniProtKB | ChEBI) | ||||
Sequence: T |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrial outer membrane | |
Cellular Component | mitochondrion | |
Molecular Function | ADP binding | |
Molecular Function | AMP binding | |
Molecular Function | cytochrome-b5 reductase activity, acting on NAD(P)H | |
Molecular Function | FAD binding | |
Molecular Function | flavin adenine dinucleotide binding | |
Molecular Function | NAD binding | |
Biological Process | cholesterol biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNADH-cytochrome b5 reductase 3
- EC number
- Short namesB5R; Cytochrome b5 reductase
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9DCN2
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Lipid-anchor
Mitochondrion outer membrane ; Lipid-anchor
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 2 | Decreased levels in mitochondrion and reduced activity of mitochondrial respiratory complex I. | ||||
Sequence: G → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 13 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for initiator methionine, lipidation, chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Lipidation | 2 | N-myristoyl glycine | ||||
Sequence: G | ||||||
Chain | PRO_0000019398 | 2-301 | NADH-cytochrome b5 reductase 3 | |||
Sequence: GAQLSTLSHVVLSPVWFIYSLFMKLFQRSTPAITLENPDIKYPLRLIDKEVISPDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKDTHPKFPAGGKMSQYLENMKIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSARFKLWYTVDKAPDAWDYSQGFVNEEMIRDHLPTPGEEPLILMCGPPPMIQFACLPNLERVGHPKERCFTF | ||||||
Modified residue | 42 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 43 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 50 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 120 | N6-acetyllysine | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Component of a complex composed of cytochrome b5, NADH-cytochrome b5 reductase (CYB5R3) and MTARC2 (By similarity).
Interacts with MTLN; the interaction is required to maintain cellular lipid composition and leads to stimulation of mitochondrial respiratory complex I activity (PubMed:31296841).
Interacts with MTLN; the interaction is required to maintain cellular lipid composition and leads to stimulation of mitochondrial respiratory complex I activity (PubMed:31296841).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 40-152 | FAD-binding FR-type | ||||
Sequence: DIKYPLRLIDKEVISPDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKDTHPKFPAGGKMSQYLENMKIGDTIEFRGPNGLLVYQ |
Sequence similarities
Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative promoter usage.
Q9DCN2-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsM
- Length301
- Mass (Da)34,128
- Last updated2007-01-23 v3
- Checksum984D5B73430F725D
Q9DCN2-2
- Name2
- SynonymsS
- Differences from canonical
- 1-23: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F2Z456 | F2Z456_MOUSE | Cyb5r3 | 313 |
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_012952 | 1-23 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF332059 EMBL· GenBank· DDBJ | AAK56088.1 EMBL· GenBank· DDBJ | mRNA | ||
AF332060 EMBL· GenBank· DDBJ | AAK56089.1 EMBL· GenBank· DDBJ | mRNA | ||
AK002640 EMBL· GenBank· DDBJ | BAB22252.1 EMBL· GenBank· DDBJ | mRNA | ||
BC004760 EMBL· GenBank· DDBJ | AAH04760.1 EMBL· GenBank· DDBJ | mRNA | ||
BC032013 EMBL· GenBank· DDBJ | AAH32013.1 EMBL· GenBank· DDBJ | mRNA | ||
BC043074 EMBL· GenBank· DDBJ | AAH43074.1 EMBL· GenBank· DDBJ | mRNA |