Q9DCG9 · TR112_MOUSE
- ProteinMultifunctional methyltransferase subunit TRM112-like protein
- GeneTrmt112
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids125 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Acts as an activator of both rRNA/tRNA and protein methyltransferases (PubMed:20606008, PubMed:26797129).
Together with methyltransferase BUD23, methylates the N7 position of a guanine in 18S rRNA (By similarity).
The heterodimer with HEMK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor (PubMed:20606008, PubMed:26797129).
The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species (By similarity).
Together with methyltransferase THUMPD3, catalyzes the formation of N2-methylguanosine at position 6 in a broad range of tRNA substrates and at position 7 of tRNA(Trp) (By similarity).
Involved in the pre-rRNA processing steps leading to small-subunit rRNA production (By similarity).
Together with methyltransferase METTL5, specifically methylates the 6th position of adenine in position 1832 of 18S rRNA (By similarity).
Together with methyltransferase BUD23, methylates the N7 position of a guanine in 18S rRNA (By similarity).
The heterodimer with HEMK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor (PubMed:20606008, PubMed:26797129).
The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species (By similarity).
Together with methyltransferase THUMPD3, catalyzes the formation of N2-methylguanosine at position 6 in a broad range of tRNA substrates and at position 7 of tRNA(Trp) (By similarity).
Involved in the pre-rRNA processing steps leading to small-subunit rRNA production (By similarity).
Together with methyltransferase METTL5, specifically methylates the 6th position of adenine in position 1832 of 18S rRNA (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleoplasm | |
Cellular Component | perinuclear region of cytoplasm | |
Cellular Component | protein-containing complex | |
Molecular Function | protein heterodimerization activity | |
Molecular Function | protein methyltransferase activity | |
Molecular Function | tRNA methyltransferase activator activity | |
Biological Process | peptidyl-glutamine methylation | |
Biological Process | positive regulation of rRNA processing | |
Biological Process | rRNA (guanine-N7)-methylation | |
Biological Process | rRNA methylation | |
Biological Process | transcription initiation-coupled chromatin remodeling | |
Biological Process | tRNA methylation |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMultifunctional methyltransferase subunit TRM112-like protein
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9DCG9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes to a polarized perinuclear structure, overlapping partially with the Golgi and lysosomes.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000215798 | 1-125 | Multifunctional methyltransferase subunit TRM112-like protein | |||
Sequence: MKLLTHNLLSSHVRGVGTRGFPLRLQATEVRINPVEFNPEFVARMIPKVEWAALVQAADTLNLAEVPKEPTEGYEHDETFLRKMHHVLLEVDVLEGTLQCPESGRLFPISRGIPNMLLNDEETET |
Proteomic databases
PTM databases
Expression
Tissue specificity
Abundantly expressed in the testis, also expressed in the brain, heart, kidney, liver, lung, muscle and spleen.
Gene expression databases
Interaction
Subunit
Heterodimer with BUD23/WBSCR22; this heterodimerization is necessary for the metabolic stability and activity of the catalytic subunit BUD23 (By similarity).
Heterodimer with N6AMT1/HEMK2; this heterodimerization is necessary for S-adenosyl-L-methionine-binding to N6AMT1/HEMK2 (PubMed:26797129).
Heterodimer with ALKBH8 (By similarity).
Heterodimer with METTL5; this heterodimerization is necessary for the stability of the catalytic subunit METTL5 (By similarity).
Interacts with THUMPD3; the interaction is direct and is required for THUMPD3 methyltransferase activity (By similarity).
Interacts with THUMPD2 (By similarity).
Heterodimer with N6AMT1/HEMK2; this heterodimerization is necessary for S-adenosyl-L-methionine-binding to N6AMT1/HEMK2 (PubMed:26797129).
Heterodimer with ALKBH8 (By similarity).
Heterodimer with METTL5; this heterodimerization is necessary for the stability of the catalytic subunit METTL5 (By similarity).
Interacts with THUMPD3; the interaction is direct and is required for THUMPD3 methyltransferase activity (By similarity).
Interacts with THUMPD2 (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 2-119 | TRM112 | ||||
Sequence: KLLTHNLLSSHVRGVGTRGFPLRLQATEVRINPVEFNPEFVARMIPKVEWAALVQAADTLNLAEVPKEPTEGYEHDETFLRKMHHVLLEVDVLEGTLQCPESGRLFPISRGIPNMLLN |
Sequence similarities
Belongs to the TRM112 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length125
- Mass (Da)14,141
- Last updated2001-06-01 v1
- ChecksumA749605B3982A6F6
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q8VCR4 | Q8VCR4_MOUSE | Trmt112 | 108 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 85 | in Ref. 1; BAB22695 | ||||
Sequence: H → Q | ||||||
Sequence conflict | 122 | in Ref. 2; AAH16191 | ||||
Sequence: Missing |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK002791 EMBL· GenBank· DDBJ | BAB22361.1 EMBL· GenBank· DDBJ | mRNA | ||
AK003292 EMBL· GenBank· DDBJ | BAB22695.1 EMBL· GenBank· DDBJ | mRNA | ||
BC016191 EMBL· GenBank· DDBJ | AAH16191.1 EMBL· GenBank· DDBJ | mRNA |